KEGG   Paralichthys olivaceus (Japanese flounder): 109638615
Entry
109638615         CDS       T06037                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
SSDB
Motif
Pfam: RA Nore1-SARAH Ras_bdg_2 Ribosomal_L6e
Other DBs
NCBI-GeneID: 109638615
NCBI-ProteinID: XP_019957236
LinkDB
Position
Unknown
AA seq 276 aa
MSNAASSSDKTPSFEMTWGSSASSGYCSEEEPDPEFEQFFTARTSFFPKTKKPDLNVKKD
EQTECGKQELTTAVIQQKVKEYNAQINSNLFMNMNKDGSYTGFIKVQFKLARPVSVPHPK
KGGHDAGGRKASGVKRRTSFYLPKDASKHLHISSRTSAREVIEALLKKFTVVDNPGKFAL
FERSERHDQVYVRKLSDNERPLRLRLSSGPNEKVLSFVLKENETGEVNWHAFSMPELKNF
LRILQREEEEHVKQIVQRYALARTKMQETLAGSTPG
NT seq 831 nt   +upstreamnt  +downstreamnt
atgtcaaacgcggccagcagctcggacaagaccccctccttcgagatgacctggggcagc
tccgccagcagcggctactgcagcgaggaggagcccgaccccgagttcgagcagttcttc
accgcccggacatccttcttccccaaaaccaagaagcccgacttaaatgttaagaaggat
gaacaaactgaatgtggaaagcaggagttgacaactgcagttattcagcagaaggtgaag
gagtacaacgctcagatcaacagcaacctcttcatgaacatgaacaaggatggttcctac
actggctttattaaagtacagttcaagctggctcgacctgtgtccgttccgcatcctaag
aagggaggtcacgatgctggaggcaggaaggccagtggagtgaagcgtcgcacctctttc
tacctgccaaaggatgcgtccaagcacctgcacataagctctcgcacttctgctcgtgag
gtcattgaagccttactgaaaaagttcactgtggtggacaatcctggcaagtttgctctg
tttgagcgcagcgagcgccatgaccaagtttatgttcgcaagctatctgataacgagcgc
ccccttcgcctgcgactctcttctggacctaatgagaaagtcctcagtttcgtgctcaaa
gaaaatgaaactggggaagtcaattggcatgccttctccatgcccgagttaaagaacttc
ctgcgcattctgcagcgtgaagaagaggaacacgtcaagcagatagtgcagcgatacgcc
ctggcccgcactaagatgcaggagactctggccggctccacccccggttga

DBGET integrated database retrieval system