KEGG   Paralichthys olivaceus (Japanese flounder): 109638772
Entry
109638772         CDS       T06037                                 

Gene name
rrm2b
Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2 B isoform X1
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov00230  Purine metabolism
pov00240  Pyrimidine metabolism
pov00480  Glutathione metabolism
pov00983  Drug metabolism - other enzymes
pov01100  Metabolic pathways
pov04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109638772 (rrm2b)
   00240 Pyrimidine metabolism
    109638772 (rrm2b)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109638772 (rrm2b)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    109638772 (rrm2b)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109638772 (rrm2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pov03400]
    109638772 (rrm2b)
Enzymes [BR:pov01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     109638772 (rrm2b)
DNA repair and recombination proteins [BR:pov03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    109638772 (rrm2b)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 109638772
NCBI-ProteinID: XP_019957464
LinkDB
Position
Unknown
AA seq 364 aa
MTPTVRSSQDKALMNINLQSDDLQQKNDIKDKSAGCQRGSETEEEPLLKENSRRFVIFPI
QYPEIWRMYKQAQASFWTVEEVDLSKDLQHWDRLKPEEKYFISHILAFFAASDGIVNENL
VQRFSQEVQVPEARSFYSFQILIETVHSEMYSMLINTYIRDLKERDYLLNAIQTMPCVKR
KADWALQWINDSKSTFGERIVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRD
EGLHCSFACLLYSYLLKKPSEDRVKDIITKAVSIEQEFLTEALPVDLIGINCCLMKQYIE
FVADRLLTDLGLDKVYQAENPFDFMESISLEGKTNFFEKRVAEYQRFGVMSSMLDCKFTL
DADF
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgacaccgacggtgagaagctctcaggataaagctctgatgaatataaaccttcagtct
gacgatctccagcaaaagaatgacatcaaagataaaagtgcaggctgccagaggggttca
gagacagaggaggaacctttgctcaaggagaactccagacggtttgtcatcttccccatc
cagtaccccgaaatctggaggatgtacaagcaggcacaagcctctttctggacggtggag
gaggtcgatctatccaaagacctgcagcattgggaccggttaaaaccagaagagaagtac
ttcatctcccacatccttgccttctttgctgccagtgatggcatcgtcaatgagaacctg
gtgcagaggttcagccaggaggtgcaggtccccgaagctcgctccttctacagcttccag
atcctcatagagactgttcactcggagatgtacagcatgctcatcaacacttacattagg
gacctgaaggaaagggactacttgttaaatgccattcaaaccatgccgtgtgtgaaacgg
aaagcagactgggccctacagtggataaatgacagcaaatccacatttggtgagcgaatt
gtggcttttgctgctgtggagggaatcttcttctccggttcattcgctgccatcttttgg
ctgaagaagagaggattaatgcctgggcttaccttctccaatgagctgatcagcagggat
gagggcctgcactgcagctttgcctgcctgctgtacagctacctgctgaaaaagccatca
gaggacagagtcaaggacatcatcaccaaagctgttagcattgagcaggagtttttgaca
gaggccctgccagtggatctcattggaatcaattgttgtctaatgaaacagtacattgag
tttgtggctgaccggctgctcactgacctcggacttgataaggtttaccaagcggaaaat
ccattcgacttcatggagtccatttcgctggaggggaaaaccaacttctttgagaaacga
gtggccgagtatcagagatttggagtcatgtcgagcatgttggactgtaaattcacactg
gatgcagacttctga

KEGG   Paralichthys olivaceus (Japanese flounder): 109648224
Entry
109648224         CDS       T06037                                 

Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov00230  Purine metabolism
pov00240  Pyrimidine metabolism
pov00480  Glutathione metabolism
pov00983  Drug metabolism - other enzymes
pov01100  Metabolic pathways
pov04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109648224
   00240 Pyrimidine metabolism
    109648224
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109648224
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    109648224
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109648224
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pov03400]
    109648224
Enzymes [BR:pov01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     109648224
DNA repair and recombination proteins [BR:pov03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    109648224
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 109648224
NCBI-ProteinID: XP_019969573
LinkDB
Position
Unknown
AA seq 179 aa
MYKKAEASFWTAEEVDLSKDLQHWESLKEEERYFISHVLAFFAASDGIVNENLVERFTQE
VQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKEPKEREYLFNAIETLPCVKKKADWAIN
WIGNNKAAFGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEVSASH
NT seq 540 nt   +upstreamnt  +downstreamnt
atgtacaagaaggccgaggcatctttctggaccgcagaggaggtcgacctgtcaaaggat
ctgcagcactgggagtctctgaaggaggaggagaggtacttcatctctcacgtgttggcg
ttcttcgccgccagcgacggcatcgtcaacgagaacctggtggagcgctttacgcaggaa
gtgcaggtgaccgaggcccggtgtttctatggtttccagatcgccatggagaacatccac
tcggagatgtatagccttctcatcgacacgtacatcaaggagcccaaagagagagaatac
ctgttcaacgccatcgagactctgccgtgtgtgaagaagaaggccgactgggcgatcaac
tggatcggcaacaacaaagccgcctttggagagcgggtggtggccttcgcggcagtggag
ggaatcttcttctctggttcgttcgcttccatcttctggctgaagaagagaggtctcatg
cccggcctgaccttctccaacgagctcatcagcagagatgaggtgagcgcctcgcactaa

DBGET integrated database retrieval system