KEGG   Paralichthys olivaceus (Japanese flounder): 109639132
Entry
109639132         CDS       T06037                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04060  Cytokine-cytokine receptor interaction
pov04068  FoxO signaling pathway
pov04144  Endocytosis
pov04218  Cellular senescence
pov04350  TGF-beta signaling pathway
pov04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109639132
   04350 TGF-beta signaling pathway
    109639132
   04068 FoxO signaling pathway
    109639132
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109639132
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109639132
  09143 Cell growth and death
   04218 Cellular senescence
    109639132
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109639132
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109639132
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     109639132
Protein kinases [BR:pov01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   109639132
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal TMEM100
Other DBs
NCBI-GeneID: 109639132
NCBI-ProteinID: XP_019957983
LinkDB
Position
Unknown
AA seq 515 aa
MELLRFSAFWCGTILFGSFLLEEKEAMIIKLKRLCKFCDEQATNCTGKGRCKVECDRTAI
CLQDDDVCVSVWRKRDDNVTFDTVCHNPAQRLYGLVLDDYNNSKCEMKERKGMGAEFFIC
SCSEDECNEHIIFNSYVASQVVAVILVSLVPLMVMAVVVITSFYCYRVYRQRQASSRRKK
GPPLDFSDAHAIMIDDGSDSSSTLANNLNHNTELLPIELDVQVGKGRFAEVYKAKLKQGS
SGGEEQGFETVAIKIFRYEEYASWKNEKDIFSDADLRHENVLHFLTAEERKVQRQYWLIT
AYHPRGNLQEYLSHHIISWCDLWLLGSSLSSGVAHLHSDHTSCGRYKVAIAHRDIKSSNI
LVKSDLTCCLCDFGLAQRLDNNLSVDELANSGQVGTARYMAPEVLESRINLENIESFKQA
DVYSMALVLWEIISRCSAIGEVKEYEPPFGNLREHPCVESMKDSVLRDRGRPEIPNSWIN
HPAFIHDSLISAVKTTPPCNEKRLLRLNSKSVPTA
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggagctacttcgcttttccgctttctggtgtggaacgatactgttcggtagtttcctg
ctggaggagaaggaggccatgataatcaagttgaagaggctctgcaagttctgtgatgag
caggcaaccaactgcacaggcaaagggaggtgtaaggtggagtgcgaccgcacggccatc
tgcctccaggatgacgacgtgtgcgtcagtgtatggcggaagagagacgacaacgtcacc
tttgacacggtctgtcacaacccagctcagaggctgtacggcctcgtcctggacgattac
aacaacagcaagtgtgagatgaaggaaagaaagggaatgggtgccgagttcttcatctgc
tcctgctcggaggatgagtgcaatgagcacatcatttttaactcatacgtggcttctcag
gtggtagcggtcatcttggtgagcctggtgcctctgatggtcatggctgttgtcgtcatc
acttccttctactgctaccgggtctaccgccagcggcaagccagttccagacgcaagaag
ggcccccctctggacttcagtgacgctcacgccatcatgatagacgacggttcagacagc
agctccacgctcgccaataatctcaaccacaacacggagctgctgcccatcgagctggac
gttcaggttggaaaaggacgttttgcagaggtttacaaagcgaaactgaagcagggctcg
tcgggcggcgaggagcaggggttcgagacggtggcgattaagatattccggtatgaggag
tatgcctcctggaaaaacgagaaggacatcttctcggacgcagacttgagacacgagaat
gtgcttcacttcctgacagcagaggagcggaaggtgcagagacagtactggctcatcacg
gcctatcaccctagggggaatctgcaggagtacctgtctcatcatattataagctggtgc
gacctgtggctgctcggaagttcgctctctagcggagtggctcacctccacagtgaccat
acgtcctgcggtcgctacaaggtggctatcgcgcacagggacattaagagctccaacata
ctggtgaaaagcgatctgacctgctgcctgtgcgactttggcctcgcacagcgcctggac
aacaatctatcagtggatgagctggccaacagtgggcaggtgggtacggccaggtacatg
gccccagaggtgttggagtcgagaatcaacctagaaaacattgagtcttttaaacaggct
gacgtctactccatggctctcgtactgtgggagatcatttccaggtgtagtgcaatcgga
gaggtgaaagagtacgagccgcccttcggcaacctgagggagcacccgtgtgtggagagc
atgaaggacagcgttctccgtgacagaggacgacctgagatccccaacagctggatcaac
cacccggcttttattcatgactctcttatctctgctgttaaaacaactcctccttgcaac
gaaaaacgtctgctcagactcaactctaaatctgttcccacagcatga

DBGET integrated database retrieval system