KEGG   Paralichthys olivaceus (Japanese flounder): 109639207
Entry
109639207         CDS       T06037                                 

Definition
(RefSeq) insulin-like growth factor-binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109639207
   04218 Cellular senescence
    109639207
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pov04131]
    109639207
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pov04147]
    109639207
Membrane trafficking [BR:pov04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    109639207
Exosome [BR:pov04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109639207
SSDB
Motif
Pfam: IGFBP Thyroglobulin_1
Other DBs
NCBI-GeneID: 109639207
NCBI-ProteinID: XP_019958114
LinkDB
Position
Unknown
AA seq 267 aa
MPGACVLLLAAALAAFARLVGTVGPVVRCEPCDAGALLQCKPLPKDCAERMKEPGCGCCM
TCALREGQACGVYTARCGFGLTCQHQPGESRPLQALLEGRGVCSTAASKKLNSILIPAQK
PEGGGNQVEEGFANATQTMTVLTGVATVKGGHGRGSMDTRPPLHNKLIQKDQNRKTQSYK
VESVSGGANMDMHNFSLESKRETEYGPCRREMESILNSLKISNVLNPRGFRIPNCDRKGF
YKKKQLQLSSLVLYESWDRLAQEGFTR
NT seq 804 nt   +upstreamnt  +downstreamnt
atgcccggtgcctgtgtgcttttactcgccgctgcgctggctgcgttcgcccggctcgtc
ggcaccgtggggccggtggtccggtgcgagccgtgcgacgccggggcgctcctgcagtgc
aagcccctgccgaaggactgcgcggagcggatgaaggagcccggctgcggctgctgcatg
acgtgcgccctgcgcgagggacaggcgtgtggagtgtacacggcgcgctgcggcttcggc
ttgacctgccagcaccagccgggggagagccgacccctgcaagcgctgctggagggacgg
ggagtgtgctccactgccgcgtccaaaaaactcaacagcatcctcataccagcgcaaaaa
ccagagggtggaggaaatcaagtagaagaaggttttgccaatgctacgcagacgatgacg
gtgctgaccggcgtggcaactgtgaagggtggacacggtcggggttcgatggacaccagg
cctccgctgcacaacaagctgatccagaaagatcagaacaggaagacgcagagctacaag
gtggagtcagtgtcaggaggagccaacatggacatgcacaacttctccctggagagcaag
agggagactgagtatgggccgtgtcggcgggagatggagagcatcctgaacagtcttaaa
atcagcaacgtgctcaaccccagaggcttccgcatacccaactgtgacagaaagggcttc
tacaagaaaaaacagttgcagctctcgtcactggtgctctatgaatcctgggataggttg
gcccaagaaggattcacccgttag

KEGG   Paralichthys olivaceus (Japanese flounder): 109641634
Entry
109641634         CDS       T06037                                 

Definition
(RefSeq) insulin-like growth factor-binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109641634
   04218 Cellular senescence
    109641634
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pov04131]
    109641634
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pov04147]
    109641634
Membrane trafficking [BR:pov04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    109641634
Exosome [BR:pov04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109641634
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP
Other DBs
NCBI-GeneID: 109641634
NCBI-ProteinID: XP_019961711
LinkDB
Position
Unknown
AA seq 294 aa
MLQDAAMDARLRALCMTFFLASISRRSGAVGPVIRCEPCDVGARLLCKPLAKDCTERVRE
PGCGCCMTCALSFGQPCGVYTGRCGSGLTCQHQPGETKPLQALLEGRGICANATNRRLTV
RPTPPVNELPAESIDTQDEERNSSGPGLQILYSTHRPTGPLRPPLHAFFPSARSEVLRQE
QQRRTQSFKMVLPGTLITDQQNFSLETKQEPEYGPCRREIESILSSLKITDILNPRGFRI
PNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGFDGKERGDTQHYNSESQ
NT seq 885 nt   +upstreamnt  +downstreamnt
atgctccaggacgccgccatggatgcccgtctccgcgcactttgcatgacatttttcctg
gcgtcgatcagccggaggtcaggtgcggtgggaccggtgatcagatgcgagccgtgcgac
gtcggagcgcggctcctgtgcaaacctctggccaaggactgcaccgagagggtccgcgag
ccgggctgcggctgctgcatgacctgcgcgctcagcttcggtcagccgtgcggcgtgtac
accgggagatgtggctccgggctgacatgtcagcatcagcccggcgagacgaagcctctg
caggctctgctggagggacggggcatctgtgcaaacgccacaaacaggagactcaccgtc
agaccgacacctccggtcaatgaactgccagcagagagcattgacactcaggatgaggag
cggaactccagcggcccaggcctccagatcttgtacagcacccaccggcccacgggaccc
ctgagacccccgcttcacgctttcttcccctctgccaggtcagaagtcctgagacaggag
cagcagaggcgaacccagagctttaaaatggtcctcccgggaacactcatcacggaccag
cagaacttctctctggagaccaaacaggagcctgagtatggtccctgtcggagagagatt
gagagcattctcagcagcctcaagattacagacattctcaaccccagaggtttccgcata
ccaaactgtgacaagaagggcttctataagaaaaagcagtgccgtccatccaagggcaga
aagcgcggcttctgttggtgtgtggacaagtatggtcagccactgccaggttttgatggg
aaggagcggggagacacccagcactacaactcagagagccaatag

KEGG   Paralichthys olivaceus (Japanese flounder): 109643988
Entry
109643988         CDS       T06037                                 

Definition
(RefSeq) insulin-like growth factor-binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109643988
   04218 Cellular senescence
    109643988
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pov04131]
    109643988
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pov04147]
    109643988
Membrane trafficking [BR:pov04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    109643988
Exosome [BR:pov04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109643988
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP
Other DBs
NCBI-GeneID: 109643988
NCBI-ProteinID: XP_019964814
LinkDB
Position
Unknown
AA seq 286 aa
MPGACVLLLAAALAAFARLVGTVGPVVRCEPCDAGALLQCKPLPKDCAERMKEPGCGCCM
TCALREGQACGVYTARCGFGLTCQHQPGESRPLQALLEGRGVCSTAASKKLNSILIPAQK
PEGGGNQVEEGFANATQTMTVLTGVATVKGGHGRGSMDTRPPLHNKLIQKDQNRKTQSYK
VESVSGGANMDMHNFSLESKRETEYGPCRREMESILNSLKISNVLNPRGFRIPNCDRKGF
YKKKQCRPSKGRRRGYCWCVDKYGQPLPGLDGRERGETQCYNLESK
NT seq 861 nt   +upstreamnt  +downstreamnt
atgcccggtgcctgtgtgcttttactcgccgctgcgctggctgcgttcgcccggctcgtc
ggcaccgtggggccggtggtccggtgcgagccgtgcgacgccggggcgctcctgcagtgc
aagcccctgccgaaggactgcgcggagcggatgaaggagcccggctgcggctgctgcatg
acgtgcgccctgcgcgagggacaggcgtgtggagtgtacacggcgcgctgcggcttcggc
ttgacctgccagcaccagccgggggagagccgacccctgcaagcgctgctggagggacgg
ggagtgtgctccactgccgcgtccaaaaaactcaacagcatcctcataccagcgcaaaaa
ccagagggtggaggaaatcaagtagaagaaggttttgccaatgctacgcagacgatgacg
gtgctgaccggcgtggcaactgtgaagggtggacacggtcggggttcgatggacaccagg
cctccgctgcacaacaagctgatccagaaagatcagaacaggaagacgcagagctacaag
gtggagtcagtgtcaggaggagccaacatggacatgcacaacttctccctggagagcaag
agggagactgagtatgggccgtgtcggcgggagatggagagcatcctgaacagtcttaaa
atcagcaacgtgctcaaccccagaggcttccgcatacccaactgtgacagaaagggcttc
tacaagaaaaaacagtgccgtccatccaaaggcaggaggcggggatactgctggtgcgtg
gacaaatacgggcagcctctgcccggcctggacggcagagagcgaggcgagacgcagtgc
tacaacctggagagcaaatga

DBGET integrated database retrieval system