KEGG   Paralichthys olivaceus (Japanese flounder): 109639504
Entry
109639504         CDS       T06037                                 

Definition
(RefSeq) mitogen-activated protein kinase 1-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04012  ErbB signaling pathway
pov04068  FoxO signaling pathway
pov04114  Oocyte meiosis
pov04140  Autophagy - animal
pov04150  mTOR signaling pathway
pov04210  Apoptosis
pov04218  Cellular senescence
pov04261  Adrenergic signaling in cardiomyocytes
pov04270  Vascular smooth muscle contraction
pov04350  TGF-beta signaling pathway
pov04370  VEGF signaling pathway
pov04371  Apelin signaling pathway
pov04510  Focal adhesion
pov04520  Adherens junction
pov04540  Gap junction
pov04620  Toll-like receptor signaling pathway
pov04621  NOD-like receptor signaling pathway
pov04625  C-type lectin receptor signaling pathway
pov04810  Regulation of actin cytoskeleton
pov04910  Insulin signaling pathway
pov04912  GnRH signaling pathway
pov04914  Progesterone-mediated oocyte maturation
pov04916  Melanogenesis
pov05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109639504
   04012 ErbB signaling pathway
    109639504
   04350 TGF-beta signaling pathway
    109639504
   04370 VEGF signaling pathway
    109639504
   04371 Apelin signaling pathway
    109639504
   04068 FoxO signaling pathway
    109639504
   04150 mTOR signaling pathway
    109639504
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109639504
  09143 Cell growth and death
   04114 Oocyte meiosis
    109639504
   04210 Apoptosis
    109639504
   04218 Cellular senescence
    109639504
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109639504
   04520 Adherens junction
    109639504
   04540 Gap junction
    109639504
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109639504
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109639504
   04621 NOD-like receptor signaling pathway
    109639504
   04625 C-type lectin receptor signaling pathway
    109639504
  09152 Endocrine system
   04910 Insulin signaling pathway
    109639504
   04912 GnRH signaling pathway
    109639504
   04914 Progesterone-mediated oocyte maturation
    109639504
   04916 Melanogenesis
    109639504
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109639504
   04270 Vascular smooth muscle contraction
    109639504
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109639504
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109639504
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pov03036]
    109639504
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pov04147]
    109639504
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109639504
Protein kinases [BR:pov01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109639504
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     109639504
Exosome [BR:pov04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109639504
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH YukC Choline_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 109639504
NCBI-ProteinID: XP_019958561
LinkDB
Position
Unknown
AA seq 395 aa
MADLCCTAAEVGAAGSDSAAADGADGTVALDVGGAPVAAVPKIESESVKGQIFDVGPRYT
NLCYIGEGAYGMVCSAMDNVTTQRVAIKKISPFEHQTYCQRTLREIKILLRFHHENIIGI
NDILRARHIDNMRDVYIVQTLMETDLYKLLKSQRLSNDHVCYFLYQILRGLKYIHSANVL
HRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYS
KSIDIWSVGCILAEMLSNKPIFPGKHYLDQLNHILGVLGSPSQDDLNCIINMKARNYLQS
LPEKPKIPWEKIFNRADSKALDLLGRMLTFNPIRRISVEEALGHPYLEQYYDPSDEPVAE
EPFTFTMELDDLPKEKLKELIFEETARFQETYQGS
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggcggatttgtgctgcaccgcagcggaggtcggggccgcgggctccgacagcgccgct
gccgacggggcggatggcactgttgcgcttgatgttggtggtgcacccgtagccgcggta
cccaagatcgagtccgagtctgtgaagggccagatatttgacgtgggcccccgctacacg
aacctgtgttacatcggggagggggcgtacggaatggtgtgctctgccatggacaacgtg
acaacccagcgcgttgccatcaagaaaatcagccccttcgagcaccagacatattgccaa
cgcacactgagggaaatcaagatcctgctgcgtttccaccatgagaatatcatcggcatc
aacgacattctcagggcaaggcacattgacaacatgagggatgtctacatcgtgcagact
ctgatggagacggacctgtacaagctgctgaagagccagaggctgagcaacgaccacgtc
tgctacttcctctaccagatcctgcgaggcctcaagtacattcactcggccaacgtgttg
caccgtgacctcaaaccctccaacctgctcatcaacaccacctgcgacctcaagatctgt
gactttggcctggcacggatagccgaccctgagcacgaccacacaggtttcttgactgag
tacgtggccacgcgttggtacagggctccagaaatcatgctcaactccaagggctactct
aagtccatcgacatttggtcagtgggctgcatcctggctgagatgttgtccaacaagccg
atcttccctgggaaacactacttggaccagctcaaccacatactgggcgtcctcggctcc
ccatctcaagatgatctgaactgtataatcaacatgaaggcgaggaactacctgcagtcc
ctgcctgaaaaacccaagatcccctgggaaaagatcttcaacagggccgattcgaaagct
ctggacctgctgggccgcatgttgacctttaatcccatcaggcgcatcagcgttgaagag
gccctgggtcatccttacctggagcagtactatgatccctcagatgagccagtagcggag
gagcccttcactttcaccatggagctggatgacctacccaaggagaagctgaaggaactg
atctttgaggaaacggctcgtttccaggaaacctaccagggctcttga

KEGG   Paralichthys olivaceus (Japanese flounder): 109640677
Entry
109640677         CDS       T06037                                 

Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04012  ErbB signaling pathway
pov04068  FoxO signaling pathway
pov04114  Oocyte meiosis
pov04140  Autophagy - animal
pov04150  mTOR signaling pathway
pov04210  Apoptosis
pov04218  Cellular senescence
pov04261  Adrenergic signaling in cardiomyocytes
pov04270  Vascular smooth muscle contraction
pov04350  TGF-beta signaling pathway
pov04370  VEGF signaling pathway
pov04371  Apelin signaling pathway
pov04510  Focal adhesion
pov04520  Adherens junction
pov04540  Gap junction
pov04620  Toll-like receptor signaling pathway
pov04621  NOD-like receptor signaling pathway
pov04625  C-type lectin receptor signaling pathway
pov04810  Regulation of actin cytoskeleton
pov04910  Insulin signaling pathway
pov04912  GnRH signaling pathway
pov04914  Progesterone-mediated oocyte maturation
pov04916  Melanogenesis
pov05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109640677
   04012 ErbB signaling pathway
    109640677
   04350 TGF-beta signaling pathway
    109640677
   04370 VEGF signaling pathway
    109640677
   04371 Apelin signaling pathway
    109640677
   04068 FoxO signaling pathway
    109640677
   04150 mTOR signaling pathway
    109640677
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109640677
  09143 Cell growth and death
   04114 Oocyte meiosis
    109640677
   04210 Apoptosis
    109640677
   04218 Cellular senescence
    109640677
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109640677
   04520 Adherens junction
    109640677
   04540 Gap junction
    109640677
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109640677
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109640677
   04621 NOD-like receptor signaling pathway
    109640677
   04625 C-type lectin receptor signaling pathway
    109640677
  09152 Endocrine system
   04910 Insulin signaling pathway
    109640677
   04912 GnRH signaling pathway
    109640677
   04914 Progesterone-mediated oocyte maturation
    109640677
   04916 Melanogenesis
    109640677
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109640677
   04270 Vascular smooth muscle contraction
    109640677
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109640677
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109640677
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pov03036]
    109640677
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pov04147]
    109640677
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109640677
Protein kinases [BR:pov01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109640677
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     109640677
Exosome [BR:pov04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109640677
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo
Other DBs
NCBI-GeneID: 109640677
NCBI-ProteinID: XP_019960366
LinkDB
Position
Unknown
AA seq 369 aa
MATAAVSAPAGCGPSPGSGTELVRGQAFDVGPRYSNLSYIGEGAYGMVCSAYDWDNKFRV
AIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRTPTIDQMKDVYIVQDLMETD
LYKLLRTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLA
RVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGK
HYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRCKVPWNRLFPNADPKALDLLD
KMLTFNPHNRIEVEEALAHPYLEQYYDPTDEPVAEAPFKFDMELDDLPKEKLKELIFEET
ARFQTAFRS
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggcgaccgctgcggtgtctgcccccgccggatgcggccccagccccgggtccgggacc
gagctcgtccgcggccaggccttcgacgtcgggcctcggtacagcaacctctcctacatc
ggggagggagcctacgggatggtgtgctccgcctacgactgggacaacaagttccgcgtg
gccattaagaagatcagcccctttgagcaccagacgtattgtcagcgcactctgagagaa
atcaagatcctcctgcgcttcaaacacgagaacattatcgggatcaacgacatcatccgc
acgccgaccattgaccagatgaaggacgtatatattgtccaggatctcatggagacagac
ctgtacaagctcctgaggactcaacacctgagcaacgaccacatctgctacttcctctac
cagatcctacgtgggctcaagtacatccactctgccaacgtcctgcaccgcgacctgaag
ccttccaacctcctgctcaacaccacgtgtgacctcaagatctgtgattttggcttggct
cgcgtggctgatcccgaccacgatcacactggtttcctcacagagtacgttgccactcgt
tggtaccgagcacctgagatcatgctcaactccaagggctacaccaagtccatagacatc
tggtcagtgggttgcatcctggctgagatgttgtccaacaggccaatctttcctggaaaa
cactacttggatcagctcaaccacattttgggaatccttggttctccctctcaggaggat
ctcaactgcatcatcaacatcaaggccaggaactacctgttgtcgctgcccttgcgctgc
aaagtgccgtggaaccgcctcttccccaacgctgatccaaaagctctggacctgttggac
aagatgttgacctttaaccctcacaataggatcgaggtagaggaggccctggctcatcct
tacctggagcaatactacgaccccacagatgagcccgtcgctgaggctccgttcaagttt
gacatggagctggacgatctacccaaagagaagctgaaggagctcatctttgaagagact
gcacgtttccagaccgccttcagatcctaa

DBGET integrated database retrieval system