KEGG   Paralichthys olivaceus (Japanese flounder): 109639654
Entry
109639654         CDS       T06037                                 

Definition
(RefSeq) insulin-like growth factor I
  KO
K05459  insulin-like growth factor 1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04068  FoxO signaling pathway
pov04114  Oocyte meiosis
pov04115  p53 signaling pathway
pov04150  mTOR signaling pathway
pov04510  Focal adhesion
pov04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109639654
   04068 FoxO signaling pathway
    109639654
   04150 mTOR signaling pathway
    109639654
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109639654
   04115 p53 signaling pathway
    109639654
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109639654
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109639654
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pov04052]
    109639654
Cytokines and growth factors [BR:pov04052]
 Growth factors
  Growth factors (RTK binding)
   109639654
SSDB
Motif
Pfam: Insulin Phospholip_A2_1
Other DBs
NCBI-GeneID: 109639654
NCBI-ProteinID: XP_019958804
LinkDB
Position
Unknown
AA seq 230 aa
MSGTDIVSVSVWISCHSHTRGRKPRCCGPPLLLPGYKPAGRLRYVPTDRMHSTYCSSARP
STLTVLCVQIMCLAGWPLSSEATRLRCGSDLLSDLIFVCGDRGIYLGKGTWSGYGGRPRG
KGIVDQCCRTGGCDLQHLEKYCAKPKSQELTTAGPATTTTAQTTTQQDMAQQFEAVFHKK
LLEHLGTPDSPKREAYRKRKQPQRKNKVSSSKRRIKPAHPTGLPHPVTER
NT seq 693 nt   +upstreamnt  +downstreamnt
atgagtgggacggatatcgtgtctgtgagtgtgtggatatcctgtcacagtcacacgagg
gggaggaaacctcggtgctgtggtcctcccctcctgctgcctgggtataagcccgcaggt
cggctgaggtacgtccccacagacaggatgcactccacgtactgctcctctgccagacca
tcgacactcacagtgttgtgtgtgcagatcatgtgtctggcaggctggcccctgtcctca
gaggcaaccagactccgctgtggttcggatctcctcagtgacctcatatttgtgtgtggt
gatcgtgggatatatttaggtaaaggtacgtggtctggttacggtggtcggcccagaggg
aaggggatagtcgatcagtgctgccgaacagggggctgtgacctccagcatctggagaag
tactgtgccaaaccaaagagccaggaacttaccaccgctgggccagccacaaccacaacg
gcacaaaccacgacacagcaagatatggcacagcagttcgaagcagtatttcacaagaaa
cttttagagcacctgggcactcccgacagtccaaagagggaagcgtacagaaagagaaaa
cagccccaaaggaaaaacaaagtttcctcatcaaaaaggaggattaaaccagcacatcca
acaggcctccctcaccctgtgacagagcgatga

KEGG   Paralichthys olivaceus (Japanese flounder): 109640767
Entry
109640767         CDS       T06037                                 

Gene name
igf1
Definition
(RefSeq) insulin-like growth factor I
  KO
K05459  insulin-like growth factor 1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04068  FoxO signaling pathway
pov04114  Oocyte meiosis
pov04115  p53 signaling pathway
pov04150  mTOR signaling pathway
pov04510  Focal adhesion
pov04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109640767 (igf1)
   04068 FoxO signaling pathway
    109640767 (igf1)
   04150 mTOR signaling pathway
    109640767 (igf1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109640767 (igf1)
   04115 p53 signaling pathway
    109640767 (igf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109640767 (igf1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109640767 (igf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pov04052]
    109640767 (igf1)
Cytokines and growth factors [BR:pov04052]
 Growth factors
  Growth factors (RTK binding)
   109640767 (igf1)
SSDB
Motif
Pfam: Insulin K1377 CENP-U
Other DBs
NCBI-GeneID: 109640767
NCBI-ProteinID: XP_019960503
LinkDB
Position
Unknown
AA seq 186 aa
MSSALSFQWHLCDVFKSAMCCISCSHTLSLLLCVLTLTPTATGAGPETLCGAELVDTLQF
VCGERGFYFSKPTGYGPNARRSRGIVDECCFQSCELRRLEMYCAPAKTSKAARSVRAQRH
TDMPRAPKVSTAGHKVDKGTERRTAQQPDKTKNKKRPLPGHSHSSFKEVHQKNSSRGNTG
GRNYRM
NT seq 561 nt   +upstreamnt  +downstreamnt
atgtctagcgctctttcctttcagtggcatttatgtgatgtcttcaagagtgcgatgtgc
tgtatctcctgtagccacaccctctcactactgctgtgtgtcctcaccctgactccgacg
gcaacaggggcgggaccggagaccctgtgcggggcggagctggtcgacacgctgcagttt
gtgtgtggagagagaggcttttatttcagtaaaccaacaggttatggccccaatgcacgg
cggtcacgcggcattgtggacgagtgctgcttccaaagctgtgagctgcggcgcctggag
atgtactgtgcacctgccaagactagcaaggcagctcgctctgtgcgtgcacaacgccac
acagacatgccgagagcacctaaggttagtaccgcagggcacaaagtggacaagggcaca
gagcgtaggacagcacagcagccagacaagacaaaaaacaagaagagacctttaccggga
catagtcactcatcctttaaggaagtccatcagaaaaactcaagtcgaggcaacacgggc
gggcgaaattacagaatgtag

DBGET integrated database retrieval system