KEGG   Paralichthys olivaceus (Japanese flounder): 109639698
Entry
109639698         CDS       T06037                                 

Gene name
epo
Definition
(RefSeq) LOW QUALITY PROTEIN: erythropoietin
  KO
K05437  erythropoietin
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109639698 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pov04052]
    109639698 (epo)
Cytokines and growth factors [BR:pov04052]
 Cytokines
  CSF and other factors
   109639698 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 109639698
NCBI-ProteinID: XP_019958856
LinkDB
Position
Unknown
AA seq 204 aa
MGNRRTYGPNREEPVKGYAGDAMEFPRLLALLLVVLELTRPSLPSPLKPICDLRVLNHFI
KEAQDAEVAMKSCSEGCGLSYSVTVPPTTVNLDVWEKKNALEQNEEVQSGLRLLQQALRL
LRTSVTNTALHSHIDNSIRNLNSINAVVSRHKIQEYTPPTRAAGLEGTWIVSSAADLLKD
YVNFLRGKVQLLLSGAQACQTDVS
NT seq 615 nt   +upstreamnt  +downstreamnt
atgggcaatagacggacctatgggccaaaccgcgaggagcctgtgaagggctatgcggga
gacgctatggagtttcccagactgcttgccttgctcttggtggtgttggagttgacccgg
ccaagcctaccgtccccactgaaacccatctgtgacctgagggtcctgaaccatttcatt
aaggaggcgcaggacgcagaagtcgctatgaagtcatgtagtgaaggatgcggcctgtcc
tactctgtcactgttcccccaaccacagtcaacctagatgtctgggagaagaaaaatgca
ctggagcaaaacgaggaggtgcagtccggcctgcggctcctacaacaggccctcagattg
ctgagaacctctgtcaccaacacggcgctacacagccacatagataactccataagaaac
ctgaacagcatcaacgctgtggtgagccgtcacaaaatccaggaatataccccaccaacg
agggcagctgggcttgagggaacatggatcgtgtcctctgcagcagatttgcttaaagac
tatgtcaatttcttgcggggcaaagtgcaactcctcctttcgggcgcacaggcttgtcag
acggatgtcagctga

DBGET integrated database retrieval system