KEGG   Paralichthys olivaceus (Japanese flounder): 109639745
Entry
109639745         CDS       T06037                                 

Gene name
steap3
Definition
(RefSeq) metalloreductase STEAP3
  KO
K10142  metalloreductase STEAP3 [EC:1.16.1.-]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    109639745 (steap3)
   04115 p53 signaling pathway
    109639745 (steap3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pov04131]
    109639745 (steap3)
Enzymes [BR:pov01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.-  
     109639745 (steap3)
Membrane trafficking [BR:pov04131]
 Exocytosis
  Others
   Others
    109639745 (steap3)
SSDB
Motif
Pfam: F420_oxidored Ferric_reduct IlvN NAD_binding_2 2-Hacid_dh_C Shikimate_DH
Other DBs
NCBI-GeneID: 109639745
NCBI-ProteinID: XP_019958926
LinkDB
Position
Unknown
AA seq 490 aa
MPDDMARPLVRGRGEGGASRNLEALMPEPGALVIGILGTGDFSRSLARRLVASGYHVVVG
SRNPKRSLALFPEDAEVTSQMEAATQADLIFMAVFPEHHSTLLQLKPALAGKTLVDVSNG
LHLNRDGPSNANQLADLFPESFVVKGFNTISAWTLQVGPRDGSRQIFLCSDNPNAKNSVM
QLCRRMGFVPVDMGFLSSSLEIENLPFYLFPSWHIPVICTLSLFFVFYLYNFLRDILHPF
IKEGKSVFYKMPIETVNVTLPSVALVMLALVYLPGLCAAYLQLYWGTKYNRFPNWLDRWL
TRRKQFGLCSFLCAVLHAVYSLCLPMRKSARYKLLNAAFKQVKQGVEDSWVDEEVWRMEL
YLSVGIMALGLLSLLAVTSLPSVANAVNWREFSFIQSTLGYCALSMATIHTLLFGWDRAF
APDQYRFHLPPTFVLVLILPMVALLGRLALLLPCVALRLRKIRRGWERSQHIRFTLTDGH
SNGLEDVSNV
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgcctgatgacatggcgaggcctttagtccgaggcagaggtgaaggaggcgcctccaga
aatctcgaagccctcatgcctgaacccggcgctctggtgattggcatcttgggcacgggc
gacttctcccgttcgctggccaggaggctggtggcctccggctaccacgtggtggtgggg
agtcgaaaccccaaacgctctttggctctgttcccagaggacgctgaggtgacgtctcag
atggaggcagccactcaggcagacctgatttttatggctgtgtttccggagcatcactcc
acgctgctgcagttaaagccggcattagcggggaagacgctggtggacgtcagcaatggt
ttgcacctcaaccgagatgggccttcaaatgccaaccagctggcagatctgtttccagaa
agttttgtagtgaaagggttcaacaccatatcggcctggactctccaggtgggccctcgg
gatggaagcaggcagattttcctctgcagtgacaatcctaatgccaagaactcagtgatg
cagctgtgtcgcagaatgggctttgtccctgtggatatgggcttcctctcctcttctctg
gaaatcgaaaacctccccttctacctatttccctcctggcacatccccgtcatctgtact
ctgtcgctgttcttcgttttctacctgtacaacttcctccgtgacatcctgcatcccttc
atcaaagaaggaaagagtgttttctacaaaatgcccatcgagactgtcaatgtcactctt
ccctccgtggccttggtgatgttagcgctggtctacctgcctggtctgtgtgctgcttac
ctccagttgtactggggcaccaagtacaatcgcttccccaactggctggaccgctggcta
accaggaggaagcagtttggactgtgcagcttcctgtgcgcagttctgcatgccgtctac
agcctgtgtctccccatgagaaagtcggcccgctacaaactgctcaatgccgcttttaaa
caggtgaagcagggggtggaggactcgtgggtggacgaggaggtgtggaggatggagctg
tacctctcggtgggcatcatggctctcgggctgctctctttgctcgccgtcacctcgctg
ccctctgtggccaacgctgtcaactggagggagttcagcttcatacagtccacactaggt
tactgcgccttgtccatggccaccatccacacgctcctcttcggctgggatcgcgccttc
gctccggaccagtaccgcttccacctgccccccaccttcgtgctggtcctgatcctcccg
atggtggcgctgctgggccgcctggcgctcctcctgccctgcgtggcccttcggctccgg
aagatccgccgcggctgggagaggagccagcacatccgcttcaccctgacggacggccac
agcaacgggctggaggacgtcagtaatgtgtga

DBGET integrated database retrieval system