KEGG   Paralichthys olivaceus (Japanese flounder): 109639858
Entry
109639858         CDS       T06037                                 

Definition
(RefSeq) cyclin-dependent kinase 1-like
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04110  Cell cycle
pov04114  Oocyte meiosis
pov04115  p53 signaling pathway
pov04218  Cellular senescence
pov04540  Gap junction
pov04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109639858
   04114 Oocyte meiosis
    109639858
   04115 p53 signaling pathway
    109639858
   04218 Cellular senescence
    109639858
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109639858
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109639858
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109639858
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pov03032]
    109639858
   03036 Chromosome and associated proteins [BR:pov03036]
    109639858
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pov04147]
    109639858
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109639858
    2.7.11.23  [RNA-polymerase]-subunit kinase
     109639858
Protein kinases [BR:pov01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109639858
DNA replication proteins [BR:pov03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    109639858
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109639858
Exosome [BR:pov04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109639858
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Seadorna_VP7
Other DBs
NCBI-GeneID: 109639858
NCBI-ProteinID: XP_019959098
LinkDB
Position
Unknown
AA seq 374 aa
MEDYLKIEKIGEGTYGVVYKGRHKATGQVVAMKKIRLESEEEGVPSTAVREVSLLQELKH
PNVVRLLDVLMQESRLYLIFEFLSMDLKKYLDSIPSGQYMDPMLVKSYLYQILEGIYFCH
CHRVLHRDLKPQNLLIDNKGVIKLADFGLARAFGVPVRVYTHEVVTLWYRAPEVLLGSPR
YSTPVDVWSTGTIFAELATKKPLFHGDSEIDQLFRIFRTLGTPNNDVWPDVESLPDYKNT
FPKWKAGNLSSMVKTLDKNGLDLLAVRNAAELYWKELNCSYLGKYCIKCFGLYSYHVRLT
LDLEGFFLSKPASQIKVIVETSLNCDAIFHPMFLDSCHFSPRHHREPPASPSATATARAW
TGGVMHTITRCELY
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggaagactacttgaaaatagagaaaattggagaaggtacctatggggttgtgtataag
ggccggcacaaggctacagggcaggttgtggccatgaagaagatccgtttggagagtgag
gaggagggggtgcccagcactgctgtcagagaggtctccctgctacaagagctcaagcat
cccaacgttgtacgactcctagatgtcctgatgcaggagtctcgtctctacctcatcttt
gagttcctgtccatggacctgaagaagtacctggattcaatcccctccggccagtacatg
gaccctatgctggtcaagagctacctgtaccagatcttggagggaatttatttctgtcac
tgtcatcgagtccttcaccgggacttgaaaccccaaaacctactgatcgacaacaagggg
gttatcaaactggcagactttggccttgctcgggcttttggtgttcctgtcagggtctac
acccatgaggttgtaactctttggtaccgggccccagaagtcctcctgggttcaccccgt
tattcaacccctgttgacgtttggagcactggaaccatctttgctgaacttgccacaaag
aagcctctgttccacggagactcagaaatagaccagctcttcaggatcttcaggactctg
ggaaccccaaacaatgatgtatggccagatgtagagagtctaccagactacaaaaacacc
ttccctaaatggaaggctggtaacctctcatcaatggtgaaaactctggataagaatggg
cttgaccttctggcggtaaggaatgcagctgaactgtattggaaggagttaaattgtagt
tatttaggaaaatattgcataaaatgtttcggtttgtactcttaccacgtgaggttaaca
ctggaccttgaaggtttctttctctccaaaccagccagtcagataaaagtcattgtcgaa
actagtctgaactgtgatgccatcttccacccaatgttcctggacagttgccattttagt
ccgaggcaccacagggagcctcctgcttcaccatctgctacagcaactgcacgagcatgg
accgggggggtgatgcacaccatcaccaggtgtgagctgtactga

DBGET integrated database retrieval system