KEGG   Paralichthys olivaceus (Japanese flounder): 109639913
Entry
109639913         CDS       T06037                                 

Definition
(RefSeq) uncharacterized protein LOC109639913 isoform X1
  KO
K04726  BH3 interacting domain death agonist
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04210  Apoptosis
pov04217  Necroptosis
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109639913
   04217 Necroptosis
    109639913
   04115 p53 signaling pathway
    109639913
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109639913
SSDB
Motif
Pfam: BID Ribosomal_L27_C
Other DBs
NCBI-GeneID: 109639913
NCBI-ProteinID: XP_019959192
LinkDB
Position
Unknown
AA seq 230 aa
MNGASLIDTTYSQEVNSFPARDTNAEWVASSMDNLCMDVTGGSSVALVILAFLQADCRDS
EFRKELHSLGNEFKLTRDINCNAPSIDQLEDGDLETDGHLPGGVSVSLQDVQPSVELQWP
RNDEAVANIQQVAEGLREIAAQLEESVLAQATSNLRRNISDSPSEQWKNHLTLEVDRIMR
HGIGLEHLPQERVFMALTLTLVKGVCEQAPQLLRSLFYAALQYITPARAR
NT seq 693 nt   +upstreamnt  +downstreamnt
atgaacggcgcgtcactgatcgataccacttattcacaggaggtcaacagtttcccggca
cgagacacgaatgcggagtgggttgcttcctcgatggacaacctgtgcatggatgtgacc
ggtggttcgagcgtcgccctggtcatcctggccttcctccaggcggactgtcgggactcg
gagttcaggaaggagctgcattctctgggcaacgagttcaaactcacccgggacatcaac
tgcaatgcccccagcatcgaccaattggaggacggtgacctggagaccgacggccatctg
cccggcggcgtgtccgtgtctctgcaggatgttcagccctcagtggagctgcagtggcca
aggaacgatgaagctgtagctaacattcagcaggtcgcagaggggctgagagaaatcgca
gcccagctcgaagaaagtgtcctggcccaggccaccagcaacctgaggaggaacatatca
gactccccctctgagcagtggaaaaaccatctgaccttggaggtggatcggataatgagg
cacggcattggtctggagcatctacctcaggagcgggtcttcatggccctcactctcacc
ctggttaaaggagtctgtgaacaggccccacagcttctgaggagcctcttctacgctgca
ctgcagtacatcacccctgcgagggccaggtga

DBGET integrated database retrieval system