KEGG   Paralichthys olivaceus (Japanese flounder): 109640234
Entry
109640234         CDS       T06037                                 

Gene name
zmat3
Definition
(RefSeq) zinc finger matrin-type protein 3
  KO
K10137  zinc finger, matrin type 3
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109640234 (zmat3)
SSDB
Motif
Pfam: zf-met zf-C2H2_jaz TUTase zf-C2H2_2 zf-U1
Other DBs
NCBI-GeneID: 109640234
NCBI-ProteinID: XP_019959681
LinkDB
Position
Unknown
AA seq 489 aa
MMQLKSGDAAYYHSAEYCRNYTSPPTVSYGHCSHYLPRLPGHENMLKPPLSLFSHPQQPF
HHMDSLHQLGPPPMAPTQPLGPPPISPAQAIGPPTMVPSQPLGPPPISATHTLRPPHITP
PHSLGPPPMVPAQPLGPPPLPHTLGPPQAIVPPTMDLTQPLGPPPLNHAQALVPPPIVAP
GAGRFPLAPGPLSSPPAPGPDPSQLPPRPPGPVLIPSPVSGLIPGHLPGQAAPASEQPQD
EGSPLGMEEQEDSLGLEELCKPLYCKLCNVTLNSAQQAQAHYQGKNHSKKLRNFYAGSQQ
PPAIRIPEVLDAAGQTALNSGSTDSDTGRQALYKGATRVILATENDYCKLCDASFSSPAV
AQAHYQGKNHAKKLRLAEAQQNSNNIEGSSEAAARRNRKDGSEYKLVKNRRSPQLPVAMP
GPYYNPRPRQRIPRDLAMCVTPSGQFYCSMCNCGAEQETDFRQHLESKQHKAKVSELRYR
HEMENLGYS
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgatgcagctgaagagcggggatgcagcgtactaccacagcgcagaatactgcaggaac
tacacctcaccgcccaccgtcagctacggccactgcagccattatctgccccggctgcca
ggccatgagaacatgttgaagcctcctctgagtctcttcagtcaccctcagcagccattc
caccacatggactctctgcaccagctggggcctccacctatggcacctacgcagccgctc
ggcccaccacccatctccccggctcaggcaataggacccccaactatggttccctcccag
cctctagggccccctcccataagtgctactcacacattaaggcctccccacattacccca
ccacacagcttaggccctcctccaatggtgccagctcagcctttggggcctccacccttg
ccacacaccttggggcccccacaagcgatagtgcctccaactatggacctcacacagcca
ttagggcctccacctttgaaccatgcacaagcactggtgccaccgcctatagtggcgccc
ggagctggcagattccccctcgctcccggccctctgtcgtcccctcctgctcctggccca
gatccctcacagctgcccccacggcccccaggtccagtcctcatcccatccccggtgtct
ggcctcatccccggtcatctccctggtcaggcagccccagccagtgagcagccccaggat
gagggctctccgctggggatggaggagcaggaggactctctggggctggaggaactgtgc
aaaccgctgtactgtaaactctgcaatgttacactcaactccgctcagcaggcgcaggct
cactaccaggggaagaaccacagtaaaaagttgaggaatttctacgctgggagtcaacag
ccaccagccattaggatcccagaagtccttgatgcggcggggcagacggccctcaactca
ggatccacagacagtgacacaggcagacaggcgctgtacaagggggcgactcgggtcatc
ctggccacagagaacgactactgtaagctgtgcgatgcctccttcagttcaccggccgtt
gcacaggctcactaccagggcaagaaccacgccaagaaactacggctcgcagaggcccag
cagaattccaataacattgaaggcagcagtgaggcagccgccagaagaaacaggaaagat
ggcagcgaatacaaactggtgaaaaaccgccgcagcccacagctaccggtcgccatgcca
gggccgtactacaacccgaggccgaggcagcgcatccccagggacttggccatgtgtgtg
actcccagcggacagttctactgctccatgtgcaactgtggtgccgagcaggagacggac
ttcaggcagcatctggagagcaagcagcacaaggctaaagtgtcggagctaagataccgc
cacgagatggagaacctcggctacagttaa

DBGET integrated database retrieval system