KEGG   Paralichthys olivaceus (Japanese flounder): 109640281
Entry
109640281         CDS       T06037                                 

Definition
(RefSeq) apoptosis regulator Bcl-2-like
  KO
K02161  apoptosis regulator Bcl-2
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04140  Autophagy - animal
pov04141  Protein processing in endoplasmic reticulum
pov04210  Apoptosis
pov04217  Necroptosis
pov04261  Adrenergic signaling in cardiomyocytes
pov04340  Hedgehog signaling pathway
pov04510  Focal adhesion
pov04621  NOD-like receptor signaling pathway
pov05132  Salmonella infection
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109640281
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    109640281
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109640281
  09143 Cell growth and death
   04210 Apoptosis
    109640281
   04217 Necroptosis
    109640281
   04115 p53 signaling pathway
    109640281
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109640281
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109640281
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109640281
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109640281
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109640281
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pov01009]
    109640281
Protein phosphatases and associated proteins [BR:pov01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109640281
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3 Melibiase_2
Other DBs
NCBI-GeneID: 109640281
NCBI-ProteinID: XP_019959739
LinkDB
Position
Unknown
AA seq 228 aa
MASESNRYIVEKYICHKLSKRGYEWGFDDVRDEDEADNGSIVAPPPTLVRRCREASTGPD
NESIPSLCRRLPQSEPHDAIHRVLREAGDELERLYQPDFTEMSRQLYLTSNTAQSRFAEV
IDELFRDGVNWGRIIAFFEFGGTVCVECAAREEMTSQVENIAEWMTEYLNGPLNIWIKDN
GGWDAFVELYDRHGESVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
NT seq 687 nt   +upstreamnt  +downstreamnt
atggcgagcgagagcaatcgttatattgtagaaaagtatatctgccataaactctctaag
aggggctacgagtgggggttcgatgatgtccgggacgaggatgaagcagataacgggtcg
atagttgcccctccgccgactttggtgcgccggtgccgagaagccagcaccgggcccgac
aacgagagcatccccagcttgtgcagacggctcccgcagtccgagccacacgatgccatc
cacagggtcctgcgagaggctggggacgaacttgagagactgtaccagccggacttcacg
gagatgtcgcggcagctgtacctcacttccaacacggcgcagagtcggttcgccgaggtg
atagacgagctgttccgggacggggtgaactggggccggattatcgccttcttcgagttc
gggggcacggtgtgcgtagagtgcgcggcccgggaggagatgacatcgcaggtggagaac
atcgcggagtggatgacagagtatttgaatggacctctaaacatctggattaaagacaac
gggggatgggatgccttcgtggagctgtacgaccgacacggagagtcggtcttcagctgc
tcctggccctccatcaagacggtcttcggcctggcggcgctcggggcggccagcctcacc
atcggagcatacctgacgcagaagtga

DBGET integrated database retrieval system