KEGG   Paralichthys olivaceus (Japanese flounder): 109640530
Entry
109640530         CDS       T06037                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase Siah1
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04120  Ubiquitin mediated proteolysis
pov04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109640530
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109640530
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109640530
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pov04121]
    109640530
Enzymes [BR:pov01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     109640530
Ubiquitin system [BR:pov04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    109640530
SSDB
Motif
Pfam: Sina
Other DBs
NCBI-GeneID: 109640530
NCBI-ProteinID: XP_019960151
LinkDB
Position
Unknown
AA seq 286 aa
MDEEMSRQTATALPTGTSKCPPSQRVPTLSGTTASNSDLASLFECPVCFDYVLPPILQCQ
SGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEVTLPHTDKTE
HEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAV
DWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTW
EATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
NT seq 861 nt   +upstreamnt  +downstreamnt
atggacgaagaaatgagtcgccagactgccaccgcgctgcccacaggaacctccaagtgc
cccccctcccagcgcgtgcccaccctgtcaggcaccacggcctctaacagtgacctggcc
agcctgttcgagtgccctgtctgcttcgactatgtcctaccccccatcctgcagtgccag
tccggacacctggtatgttccaactgccggcccaagctcacctgctgccccacctgccgg
ggccccctgggctccatcaggaacctggccatggaaaaggtggctaactcggtcctcttc
ccctgcaagtacgcctcatcgggctgcgaagtcaccctgcctcacaccgacaagacggag
cacgaagagctgtgcgagttccggccgtactcctgcccctgccccggcgcctcctgcaag
tggcagggctccctggacgccgtcatgcctcatctgatgcaccagcacaagtccatcacc
acactgcagggggaggacattgtgttcctggccacagacatcaacctccccggagcggtg
gactgggtgatgatgcagtcgtgcttcggcttccacttcatgctggtgctggagaagcag
gagaagtacgacggccaccagcagttctttgccatcgtgcagctcatcggcactcgcaag
caggccgagaacttcgcctaccggctggagctcaatggtcaccggcgccgcctgacctgg
gaggccacgccgcgctccatccacgagggcatcgccacggccatcatgaacagcgactgc
ctggtgttcgacacgtccatcgcgcagcttttcgcagagaacggcaacctgggcatcaac
gtcaccatctccatgtgctaa

DBGET integrated database retrieval system