KEGG   Paralichthys olivaceus (Japanese flounder): 109640856
Entry
109640856         CDS       T06037                                 

Gene name
egr1
Definition
(RefSeq) early growth response protein 1
  KO
K09203  early growth response protein 1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04371  Apelin signaling pathway
pov04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109640856 (egr1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    109640856 (egr1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pov03000]
    109640856 (egr1)
Transcription factors [BR:pov03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    109640856 (egr1)
SSDB
Motif
Pfam: DUF3432 zf-H2C2_2 zf-C2H2 DUF3446 zf-C2H2_4 zf-C2HC_2 Zf_RING zf-BED zf-H2C2_5
Other DBs
NCBI-GeneID: 109640856
NCBI-ProteinID: XP_019960655
LinkDB
Position
Unknown
AA seq 512 aa
MAAAKTEMILPTLQISEPLSFPHSPMDNYPKLEEVMMLSSAGTPFLTASAPEGAGFGSGE
PGDQYDHLAGDTLPDIPFNCEKSVGDQTYPTQRLPPISYTGRFTLEPATSCSNSLWAEPI
LGLFTGLMSNVAPSSSSSSVASQTTLSTSSSVPSSSTSSSSTSSTSQSSSLSSSIHHNEP
NPIYSAAPTYSSPNSDIFPDQGQVFSSSAGAVQYPPPAYPNSKNCGASFPVPMIPDYLFP
QQQGEISLVPPDQKPFQSQSSQPSLTPLSTIKAFATQTGSQDLKSVYQSQLIKPSRMRKY
PTRPSKTPPHERPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLT
THIRTHTGEKPFACEICGRKFARSDERKRHTKIHLRQKDKKAEKSGAVVVTAAPVPAASP
ASSYPSPITSYPSPVSSYPSPVTSCYSSPVHTSYPSPSVATTYPSVSMSSTFQSHMASSF
PSSVTSNIYSSPVPTPLSDMQTTLSPRTIEIC
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggctgcagccaagaccgagatgatcctcccaaccctgcagatctcagagcccctgagc
ttcccccactctcccatggataactaccccaagctggaggaggtgatgatgctgagctct
gcaggcacccccttcctcaccgcctccgcacccgaaggtgcaggctttggctccggggag
ccaggagatcagtacgaccaccttgctggagatacgttacctgatatccccttcaattgt
gagaagtcggtgggtgaccaaacctaccccactcagaggctgccccccatctcttacacc
ggccgcttcacactggagcccgccaccagctgcagcaacagtctctgggcagagcccatc
ttgggcctgttcactggtctgatgagcaacgttgcccccagctccagctcttcctctgtt
gcctcacaaaccactttgtccacctcttcatctgtcccgtcctcctccacttcctcctct
tctacctcttccacatctcaaagctccagcctcagctcctccattcaccacaacgagccc
aaccccatctactcagctgccccaacctactccagtcccaactctgacatcttcccagac
cagggccaggttttttccagctcggcaggagcagtccagtaccctccccctgcctaccca
aatagcaagaactgtggcgccagcttccccgtgcccatgattcctgactatcttttccct
cagcagcagggagagatcagcctggtgccccctgaccaaaagcccttccagagtcagtca
agccagccctccctcactcctctgtccaccatcaaggcctttgccacccagactggctcc
caggacttaaagagtgtctaccagtctcagctgattaagcccagccgtatgcgcaagtac
ccaacccggccgagcaagacacccccacacgagaggccctatgcctgccccgtggagacg
tgcgatcgtcgcttctcacgctccgatgagctgacacgacatattcgcatccacacgggc
cagaaacccttccagtgccgtatctgcatgcgcaactttagccgcagcgaccacctgaca
acacacattcgcactcacactggtgagaagcccttcgcctgtgagatctgcggacgcaag
tttgcccgcagtgacgagaggaagaggcacacgaagatccacctacggcagaaggacaag
aaagcagagaagtcaggggcagtggtggtgacagcagcgccagtgccagccgcttcccct
gcctccagctacccctctccaatcacctcctacccttctcctgtgtcctcttacccctct
ccggtcacctcttgctactcctctcccgtccacacttcctatccatctccttccgtggct
accacgtatccgtcggtgtcaatgtccagcacctttcagtcccatatggcctcctccttc
ccctcctctgtcacttccaacatctacagctcccccgttcccactccgctatcagacatg
cagaccactctctccccaaggacaatcgagatctgctaa

DBGET integrated database retrieval system