KEGG   Paralichthys olivaceus (Japanese flounder): 109640857
Entry
109640857         CDS       T06037                                 

Gene name
atr
Definition
(RefSeq) serine/threonine-protein kinase ATR
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov03460  Fanconi anemia pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pov00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    109640857 (atr)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109640857 (atr)
   04115 p53 signaling pathway
    109640857 (atr)
   04218 Cellular senescence
    109640857 (atr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109640857 (atr)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pov03400]
    109640857 (atr)
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109640857 (atr)
Protein kinases [BR:pov01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   109640857 (atr)
DNA repair and recombination proteins [BR:pov03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109640857 (atr)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT UME FATC HEAT HEAT_2 DUF4080
Other DBs
NCBI-GeneID: 109640857
NCBI-ProteinID: XP_019960614
LinkDB
Position
Unknown
AA seq 2608 aa
MEGLEMSAMIPALQELASSSPAEYEQAVQKPRQILCQFIDRILTDVDVVALGLNKKSSSE
PACVMLLDFVQHIVKSSSLMFANPACQPAEYPDTTQSCNDFSKWVAVRLLRVAAAPDCDV
IHGRVSAVLRSLLHTLRVRAPFIFSHLTQELIYLAQDLGNILYAHVVALSGQGHSLGVHA
QKRWPVTLKCFSISPGCASSYLTPSPLVLSSPAALESLTAVMIGIITDALRGVVSRHDLS
AAWETACSILANGNTRLRKLSMVMLRRLVELGGFPERQGHEFFTAYLQLLETHATANTGS
DEKQPYGGELLHLTRCVFQSSGASHTHFEPIYLSQMFECVCTHGGTGVKLGTEMTESLCL
LFSFLLSVAPVYETVASLRRQRVTEVCRMLARTVGTENQAECAEGFLRAALKAETALVMQ
KSGDGESAAKKSCKSATSSVGKTTKTSSPEVDMRVRSEVWAVVNSRLEELLTLLNSDSAE
PEAQETLCALEGLALTLHLAALCSSPTSSSPLLWVSTETLGRALKSCQSVLEGGSQPVTN
QNYFQSVLQTTVEVLDSIVFLKMSSQSEDGLQRRVCALLSLPWACENKSVSIYKSSGFPS
WLSAMAQRLSFCYSPEVQVDCVSLLALLHRGVCEKWRVCVFSKALQSPEEVVRAAAVRAF
PLLLHHLGNTHHNLISSTLLSRLDDSSEQVRKELARIIGQLSCIQTELSLLSDTQVASTS
PPRKLCLCLSLAAEHAGNACPSLKATFIRPFLPLLREETPSSVKQAFLEALPHLCQHVNL
IGGDSDSRAVLCALIGLMEDKDPVVRIRFSQSVCFLLMESSRNSEQSSLNELLVARLKEA
FNNAKLNRDDDLRNTLILTTGEIGRASQGSLVSFSLLRLLHCLLSKSSPVSVAAYAQIRA
LASAKGLKLQTLFSQYKNPICQFLVESLHSRHASALRSTPDQGSESANQKELALDILAQI
AHAFDFPDLHRFLTRTLQVLLPYLAAKASSTGSSLIRTLANELKANRREILINNFKYIFS
HLVCSCTKEELERAFHYLQSETEIELGSLLRQDFQGLHNELLLRLGEHYQQVFNGLAILA
SFASNEDPYQGPRDITTPERMADYLQPKLLGILAFFNMQLLSSSAGEKDRKKLALTSVMA
LMRLMGSKHISSVRVKMMTTLRTSLRYREDFPLLCCQTWDCFVRSVEPAHLGPLLSHVIV
ALLPLIPLQPKETAAIIRFLIMDNREEVNDYLHEIYFLPDHPELKDIHSVLQDYKKLTAS
SSDLVAALQLSMRAVQHENVDVRIHALTSLRDMMHSDQEWLLRQVCASEAVEPVISSLVS
VLLKGCQDSSPEARLLCGECLGELGAVDPGRLDLSHTHTHGDRNTFVSGVDDPNFAHDLL
TELTRTFLAYADDVRAQDSGAYAIQELLSIFECREGRSDSPGRRLWRRFPEQIQEILEPH
LNSRYKSSQKEVNWSKLKKPVYLSSRGSRFSDWSATWAGYLISKVRHELAGKVFTCCSFI
IKHDYKVTIYLLPHILLYMLLGCTPAEQQEVTEEMLAVLTEGDGRGRVCVQETASSLSQL
SIQTVFSMLSHLTQWSRHILYSKPKHNESGDYQRVVAFLKGIPQDVLAKASLRSKAYTRS
LMHFEAYILENKENIQDHLTFLQTLYAAMHEPDGVRGVNALRREEPSLREQILEHESIGL
LRDATACYDRAIQLESDQIGHYHGVMTSMLGLGQLSTVITQVNGVLANKHQWKSELNTYR
VEAAWKLGKWDLLEDYLPSDRHSSTWGVRLGQLLLSAKKQDAETFYEKLKLVRKEQVVPL
SAASYECGTYQRGYEYLVRLHMLSELEHTFTELQKQRERSAPSLSQLPPHWSDRLEMTQN
SFRAKEPILALRRALLSLGSESVRQELVGECWLQSARVARKAGHHQTAFNALLNAENTHL
AELVTEKAKWLWSKGDVHQALIVLQKGVDQCFPDDESHTDPRSLQTKGKAMLLVGRFMEE
TANFESNAIMKAYKDVTNLLPEWEDGNFYLAKYYDKVMPMVTDNKLEKQGNLIRYIVTYF
GKALQFGNQYIYQAMPRMLSLWLDFGAKVCECEKAGRADRQMRQELSKINTAVTEHCANL
APYQFLTAFSQLISRVCHSSDEVFTVLIAIVAKVFLAYPQQAMWLMTAVSKSSYPMRMNR
CNQILKKAISLKKSLEKFIGDANRLTDKLLELCNKPVDGNSSTLSMGVHFKQLKRLVEEP
TFSQILIPLQSVLIPTLPSTGGANKQHDAFPGHWAYLDGFEDVVEILASLQKPKKISLKG
SDGRSYTMMCKPKDDLRKDCRLMEFNCLINKCLRKDAESRRRELHICTYAVIPLNEECGI
IEWVNNTAGLRHILTKLYKERGIYLSGKELRKLILPKTAPFEEKLRIHKEVLCARHPPVF
HEWFLRTFADPTSWYSSRSAYCRSTAVMSMVGYILGLGDRHGENILFDSFTGECVHVDFN
CLFNKGETFDVPEVVPFRLTQNMVHAMGPMGTEGLFRQACEVTLRLMRDQREPLMSVLKT
FLHDPLVEWSKQAKGLSKAQANETGEIVNEKAKTHVCDIEQRLQGVIKSRNKVLGLPLSI
EGHVHYLIQEATDDKLLCQMYLGWGPYL
NT seq 7827 nt   +upstreamnt  +downstreamnt
atggaaggactcgagatgtccgcgatgattccggctctgcaggagctggcgagctccagc
cccgcagagtacgagcaggcggtgcagaaacctcgacagatcctgtgtcagttcattgac
aggatactgacggatgtggatgtcgttgctctgggtctgaataaaaagtccagttcagaa
ccagcctgtgtgatgctcctggactttgtgcagcacatagtcaaatcctcgtctctgatg
tttgccaatcctgcctgccagcctgcggagtatccagacaccacacagagctgtaacgac
ttcagtaagtgggtggctgtgcgtttgcttcgtgtggcagcagctccggactgtgacgtc
atccacggccgcgtctctgccgtgttgcgctctttgcttcacactctgagagtccgagca
ccgttcatcttcagccacctcactcaggaactcatatatctggcccaggacctcggcaac
attctgtacgcccacgtcgtcgcactctccggacaaggacactctttgggtgtgcacgca
cagaagcgatggcccgtaacacttaaatgcttcagtatctcccccggttgcgcttcctcg
tacctcaccccttctcctcttgttctctcttcgcccgctgcgctggagtcgctgactgcc
gtgatgatcggtatcattactgacgccctcaggggtgtggtttctcgtcatgacctgagt
gcggcctgggagacggcttgctccatcctcgccaacggcaacacgaggctgagaaagctg
tccatggtgatgctgaggcgactggtggagctgggagggtttcctgagaggcaaggccat
gagttcttcacagcctaccttcagctgctggaaacacacgctacagcaaacacaggctca
gatgagaaacaaccctatggaggggagctgctacacctgactcgctgtgtgtttcagtcg
tctggtgcctctcacacacactttgagcccatctacctctcgcagatgtttgagtgtgtt
tgtactcatggaggaacaggcgtcaagttagggacagagatgaccgaatcactttgtttg
ctgttcagcttcttattgtctgttgccccagtttatgagactgttgcgtcattaaggagg
cagcgagtcacggaggtctgcaggatgctggcacgcaccgttgggacagaaaatcaagct
gaatgcgcggagggatttctccgagccgcactaaaggctgagacagctctggtgatgcag
aagtcaggagacggagagtccgctgcaaagaaatcctgcaaatcagccactagctctgtc
ggtaaaacaacgaaaacatcatcaccggaagtggacatgcgtgtccggagcgaggtgtgg
gctgtagtgaacagtcggctggaggagctgctgacgcttctgaactcggactctgctgaa
cctgaggcccaagagactctctgtgctctggagggactcgccctcaccctccacctggca
gccctctgctcctcgcccaccagttcctctcctctgctctgggtgtccactgagactctg
ggcagagctctgaagagctgtcagtcagtgttagaaggaggatctcaacctgtcacaaac
cagaactactttcaatctgttctccagacgactgttgaggtcctggactctatcgtgttc
cttaagatgagcagtcagagtgaggacggactccagcgacgtgtgtgtgctctgttatca
cttccctgggcgtgtgagaacaagtctgtctccatctacaagagttcaggtttcccctcc
tggctttctgcaatggctcagagactgagcttctgttactcacctgaggtccaggtggac
tgtgtgtcgctactggccctcctgcatcgtggtgtgtgtgagaaatggcgcgtgtgtgtg
ttttccaaggcgctgcagagtccagaggaggtggtgagagcggcggcagtcagggccttc
cctctcctgcttcaccacctgggaaacacgcatcacaacctcatcagcagtactctgctt
tccaggttggacgacagttcggagcaggtgaggaaggagcttgccaggatcattggtcag
ctgagctgcatccaaacagagctctccctgctcagtgacactcaggtggcgtccacctct
cctcccagaaaactttgcctctgccttagcctcgcagcagagcatgctgggaatgcttgt
ccatccctcaaagcaacttttatcagaccctttctgccattgctcagagaggaaactcca
agtagtgtcaaacaagctttcctagaagctctgcctcacctctgccaacatgtaaatctg
attggtggagacagtgactctcgtgcagttctctgtgctctgattggtctgatggaggac
aaggatccagtggtcagaatacgttttagccaatcagtatgtttcctgctaatggagagc
agcagaaactcagagcagagctctctgaatgagctcctggttgctcgtcttaaggaagct
ttcaacaacgcgaaactcaacagagatgatgacctgcgcaacactctcatcctgaccact
ggagagattggcagagcgtctcagggtagcttggtgtcgttctctctgctgcggctgctt
cactgtctgctctccaagtcgtccccggtgtctgtggccgcttacgctcagatcagagct
ctggcctctgccaaaggccttaaactccaaactctctttagtcagtacaagaacccaatt
tgccagttcctggtggagtcgttgcactcacgtcatgcatcagccctgcggagcacacct
gaccagggcagcgagtcagccaatcagaaagaactggccctggacatcctggctcagatc
gctcacgcttttgacttcccagacctccaccgcttcctcacacggacgctccaggtgctg
ctgccctacctggcagcaaaggcgagctctacaggctcctccctcatccgaacattggca
aatgagcttaaggcaaacaggagagagatcctgatcaacaacttcaaatacatcttcagt
catctggtgtgttcctgcaccaaggaggagctggagagggccttccactacctacagagt
gagacagagattgagctgggctccctgctcagacaggacttccagggcctccacaacgag
ctgctgctgcgtcttggagagcactaccagcaggtattcaatggtctggcaatcctggcc
tcctttgcatccaacgaagacccgtaccagggcccccgagacatcacgaccccagaacgc
atggcggactaccttcagccaaagctgctgggaattcttgcctttttcaacatgcagctg
ctcagctccagtgcaggagagaaggatcgcaaaaagctggctttgacaagtgtgatggct
ctaatgcgactcatgggctccaaacacatcagctctgtcagagtgaagatgatgacgacg
ctccgcaccagcctccgatacagagaagacttccctctgctctgctgccagacgtgggat
tgttttgtgaggagtgtggagcctgcacacctgggtcctctactgagtcatgtcattgtt
gctctcctcccactgattcctctgcagcccaaagaaacggctgctattatccgcttcctc
atcatggacaacagggaagaagtcaacgactacctccatgagatttactttctaccagat
cacccagagttaaaggacatccacagcgtcctgcaggattacaagaagctgacagccagc
agcagcgacctggtcgcagctctgcagctctcgatgagagccgtccaacatgaaaacgtt
gacgtcaggattcatgcactcacaagtctccgggatatgatgcacagtgatcaggagtgg
ctgctgcggcaggtgtgtgcgagtgaggcggtggagccagtcatctccagcttggtgtcg
gtgctgctaaagggctgccaggactcttccccagaggctcggctcctctgtggggagtgt
ctcggggagctgggagctgtggacccaggacgtctggacctgtctcacacacacacccat
ggcgaccgcaacacatttgtgagtggagttgatgatcccaattttgcccacgacctgctg
actgaactcaccagaacgttcctggcttatgctgatgatgtgagagcacaggactctggt
gcttatgcaattcaggagctgttgtccatctttgaatgtcgtgaggggcggagcgactct
ccgggtcgtcgtctgtggaggagattcccagagcagatccaagaaatactggaacctcac
ctcaacagcagatataagagcagccagaaggaggtgaactggtctaaactgaagaaacca
gtgtacttaagtagcagaggcagcaggttctctgattggtcagccacctgggctggatat
ctcatcagcaaggtgagacatgagctggccggtaaggtgttcacctgctgtagcttcatc
attaagcacgactacaaggtcacaatctacctgctgcctcacattctgctgtacatgctg
ctgggctgcacacctgcagagcaacaggaggtaacggaggagatgctggccgtactgacg
gagggtgatggtcgagggagggtgtgtgtccaggagacggcctccagcctgtcgcagctc
agcattcagactgtgttcagcatgttgtctcacctcactcagtggagccgccacatcctc
tactccaaaccaaaacacaatgagagtggagattatcagcgtgtggtggccttcctgaag
ggtattccacaggacgttctggctaaggcctctctgcgatccaaagcatacactcgttcc
ctcatgcactttgaagcttacatcctggaaaacaaagagaacatccaggaccatctcacc
ttcctgcagacgctgtacgctgcgatgcacgagcccgatggagtgaggggggtcaacgcc
ctgaggagggaggagccttcactacgggagcagatactggagcatgagagcatcggcctg
ctccgagacgccacggcctgctacgaccgggcgatacaactggagtccgatcagattggt
cactatcacggggtgatgacttctatgcttggcctgggtcagttgtccacagtcatcact
caggttaatggagtactggccaacaagcaccagtggaagtcggagcttaacacttacaga
gtggaggcagcctggaagcttggaaaatgggacttgctggaggattacttaccctctgac
cgtcactccagcacgtggggcgtgcggctcggccagttgctgttgtcggctaagaagcag
gacgctgagactttctacgagaagctgaagcttgtaaggaaggagcaggtcgtccctctg
tctgcagccagctatgagtgtggaacctaccagagaggatatgaatatcttgtcaggctc
cacatgctgagtgagttggagcacacttttactgagctgcagaaacagagagaacgctct
gcccccagtctcagccagctgcctccccattggtcagatcgtctggagatgacccagaat
tcctttagggccaaggagccaatcctggctctccgtcgtgctttgctcagcctgggatca
gaatctgtgcgtcaggagctggtcggcgagtgctggcttcaaagtgcccgagtggccagg
aaggcaggacaccaccagaccgctttcaacgctcttctgaacgcagagaacacacatctg
gccgagctggttacagagaaggccaagtggctgtggtccaagggcgatgtgcaccaggct
ctgatcgtcttgcaaaagggtgtggaccagtgttttcccgacgacgagtcccacacagac
ccccgcagcctgcagaccaaaggcaaggccatgctgctggtgggacgcttcatggaggag
acggctaacttcgagtccaacgccatcatgaaagcgtataaggacgtgacaaaccttctg
cctgagtgggaggatggaaacttctatcttgccaaatactatgacaaagtgatgccaatg
gtgactgacaacaagctggagaaacaggggaacctgatccgatacattgtcacgtacttt
ggaaaagctttgcagtttggaaaccagtacatctaccaggccatgcctcgcatgttgtct
ctctggttggactttggagccaaagtgtgtgaatgtgagaaagcgggccgagcagacaga
cagatgcgacaggagctgagtaaaatcaacacggctgtgaccgagcactgtgccaacctg
gcgccgtaccaattcttgaccgctttctcccagctcatttcccgggtgtgtcactccagc
gacgaggtcttcactgtcctcatcgcgatcgtggccaaagtcttcctggcgtacccccag
caggccatgtggctaatgactgctgtctccaagtcttcctaccccatgcgtatgaaccgc
tgtaatcagatccttaaaaaagcgatcagtctcaagaagtcgctggagaaattcattgga
gacgccaacagactgactgacaaactgttggagctctgcaacaagccggtggacggtaac
agcagcaccctcagcatgggcgtccacttcaagcagctgaaacgtctggtggaggagccg
accttcagccagattctgatcccactgcagtcggtgctcatccccacgctgccctcgacg
gggggagcaaacaagcagcacgacgccttccccggacactgggcctacctggatggcttt
gaagacgttgtggagatcttggcctccttacagaagccgaagaagatcagtctgaagggg
tcggatgggcgaagctacaccatgatgtgtaaacctaaagatgatctgaggaaggactgc
agactcatggagttcaactgcctcatcaacaagtgcctacgtaaagatgctgagtcgagg
cggagggagctacacatctgtacctacgctgtgattcccctcaatgaggagtgtggcatc
atcgaatgggtcaacaacaccgctggacttcgacacattctcaccaaactgtataaggag
agaggaatctacttgtcaggtaaagagctcaggaagctcattctgccaaagacggctccc
tttgaggagaagctccgaatccacaaggaggtactgtgtgctcgacacccccctgtcttc
cacgagtggtttctcaggaccttcgctgaccccacgtcatggtacagcagtcgctccgcg
tactgccgctccactgctgtgatgtcaatggtgggatacatcctgggtttgggagatcgc
cacggagaaaacatcctctttgactcgttcactggggaatgtgttcacgtcgacttcaac
tgcctctttaacaagggggagacatttgatgtgcctgaggttgttcccttccgtctgacc
caaaacatggtccacgctatgggacccatgggcaccgaaggcctcttcagacaagcctgc
gaggtcacactgaggctgatgagagaccagagggagccgctcatgagtgtgctcaagacc
ttccttcatgacccgctggtggagtggagcaaacaagcaaaaggactttccaaagctcag
gccaacgagactggagagatagttaatgaaaaggctaaaacccacgtgtgtgacatcgag
cagcgtctgcagggagtgataaagagcaggaacaaagtgctgggtctgcctctgtccata
gagggacacgtccactacctcatacaggaagccacagacgacaaactgctgtgtcagatg
tatctgggttgggggccctacctgtaa

DBGET integrated database retrieval system