KEGG   Paralichthys olivaceus (Japanese flounder): 109641747Help
Entry
109641747         CDS       T06037                                 

Gene name
col4a5
Definition
(RefSeq) collagen alpha-5(IV) chain
  KO
K06237  collagen, type IV, alpha
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04510  Focal adhesion
pov04512  ECM-receptor interaction
pov04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109641747 (col4a5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109641747 (col4a5)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109641747 (col4a5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pov04147]
    109641747 (col4a5)
   00536 Glycosaminoglycan binding proteins [BR:pov00536]
    109641747 (col4a5)
Exosome [BR:pov04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109641747 (col4a5)
Glycosaminoglycan binding proteins [BR:pov00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   109641747 (col4a5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen C4
Motif
Other DBs
NCBI-GeneID: 109641747
NCBI-ProteinID: XP_019961846
LinkDB All DBs
Position
Unknown
AA seq 1686 aa AA seqDB search
MEIRDTVRLCEGFGAFRLNKNICLVSPQACHGCVGSKCDCSGVKGAKGERGFPGLTGQPG
VPGFPGPEGPIGGRGEKGSDGPQGPGGPKGIRGPPGLPGFPGTPGLPGLPGQDGPPGPRG
VAGCNGTKGERGFPGTSGIPGQQGLMGPPGLPGSKGDPGDVISSNRFGDNGAVGLPGVPG
VPGSPGPPGLQGPLGPPGPRGYEGRPGPPGPPGPKGNMGLNFQGPKGEKGEPGLQGPAGP
PGQVGEQKRPPETEIQRGDKGDPGLPGPRGDPGYPGSPGPSGGQKGSKGEPGEAGKRGKP
GKDGDPGPPGYPGGKGESGLPGPPGRDGERGFKGERGFTGPPGVVIGGQTGGRVGPKGEP
GYPGSPGLKGDRGPAGSTGPPGPPGRPAVGGGGQPGPPGFPGERGQKGDGGAPGLSLPGA
PGRSGSPGSPGPQGPPGPPGFSSSAQNCVAGEPGRPGVQGERGYPGNSGQKGEKGETCVN
CFNDISSIPGEKGLPGPPGFPGNPGNPGLKGDRGFPGNPGSAGPAGAPGPQGSAGFPGEK
GDPGDAITVPGGRGEKGDTGFPGPPGLPGLDGRPGRDGQPGSPGPKGSSGSLLVKGERGP
PGEPGSPGNPGDRGPPGGPGFGPQGPSGEKGIQGVSGRPGGPGAPGAKGEPGLTVAEKGL
PGPRGQDGEPGRPGPPGDAGQFGQPGFPGLPGVKGEPGLPGIGLPGPPGSKGFPGIPGQP
GSPGGPGRPGVDGLSGQPGIPGSKGEPGFGLPGPPGLPGVPGSKGFPGPKGDPGFSGGPG
SPGRSGFDGTPGSKGEPGLSGVPGARGPPGSPSTGSFGLPGSPGAPGPMGPPGFPGSNGE
KGDPGPPGLDIPGLPGDRGNPGFPGSTGPAGTPGPPGGPGRDGLPGLPGQKGDMGPMGSP
GPSGGPGGPGGPGAPGLKGEPGFSGRDGSPGGSGIKGERGDPGVAGPPGPTLTAAAVKGT
KGDSGLPGGPGFPGQKGVSGLPGDPGLPGSDGRPGLPGPPGPKGDAGFPGGPGGPGAPGL
KGSMGEMGFPGPAGQKGLPGLSGRPGTSGQPGGPGFPGAKGEPGSAGVGPPGPPGFKGEP
GQSGFPGSPGLKGAPGSPGLSGLPGSPGTKGDPGLPGFQGSPGIPGPKGLDGGPGSPGLT
GSPGRPGEPGRPGASGFPGDKGQAGRDGIPGPAGVKGEPGLPGHGAPGASGLPGFPGAKG
DPGLPGPSGSPGFPGSKGEAGFPGSPGPSGNSGPPGPPGLAVQGPKGLQGPPGPPGRAGP
SGPPGPGGPQGPRGPAGSGGVKGEKGIPGAPGQPGFSGQKGESGVPGFPGTSGVPGGSGI
KGDIGLPGVPGFPGPKGDPGISGSNGLPGDPGDIGPVGPPGDPGLSPTPIVVKGERGPPG
PQGQQGGQGLPGSSGRDGLPGQPGNPGDPGTEGPPGFSGPPGRKGDTGPAGQPGQRGYPG
PPGSDGPQGQPGLPGTASAAHGFLITRHSQGTEVPYCPDGTSSIYDGYSLLYVQGNERAH
GQDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMSMDPLRGESIKP
FISRCSVCEAPAMVIAVHSQTIQIPSCPGNWEALWIGYSFMMHTSAGAEGSGQALASPGS
CLEEFRSAPFIECHGSGTCNYYGNSYSFWLATVEPSEMFRKPQSETLKAGNLRTRVSRCV
VCMKRT
NT seq 5061 nt NT seq  +upstreamnt  +downstreamnt
atggagattagagacacagtccgactctgtgaaggttttggagcctttcggttgaataaa
aatatttgtcttgtttctccgcaggcttgccatggatgtgtgggatccaaatgtgactgc
agtggagtgaaaggagccaaaggtgaacggggtttcccaggtctcaccggacagccaggg
gtcccagggttccccggacccgaggggccgatcggaggaagaggagagaagggcagcgac
ggacctcaaggaccaggcggtccaaaaggaatcagagggcctccaggattgcctggattt
ccaggaacaccaggtcttccgggtctgccgggtcaggacggacctccgggcccgagaggc
gtggcaggatgcaacggaacaaagggtgaacggggtttcccaggaacttccgggatccca
ggacaacagggtctaatgggaccaccaggtctgccagggtcaaagggagatccaggtgac
gtgatctccagtaatcggtttggagataatggagcagtgggattacctggagtaccagga
gttcctggctcaccggggccccctggtttacaaggtccactcgggcccccgggacccaga
ggttatgagggtcgtccaggtcctcccggtcctcctggacccaagggaaacatgggtttg
aacttccaaggacccaaaggagagaagggagaaccaggtttgcaaggacccgccggtccc
ccaggacaggtgggagaacagaagaggcccccggagacggagatccagagaggagacaag
ggcgacccaggacttcccggccctcggggtgatcccggttatccaggttctcccggcccc
tcaggtggacagaaaggaagcaagggcgaaccaggagaggccggcaaacgaggtaaacca
ggcaaagatggcgaccccggtcctccaggatacccgggaggcaaaggagagtcaggcctg
ccaggtcctccaggcagagacggagagagaggtttcaaaggagagcgtggattcacaggt
ccacctggagtggtgattggcgggcagacaggaggtagggtcggtccgaaaggtgagccc
ggataccccggatcacctggactcaaaggagatcgaggaccagcaggttcaacgggacca
ccgggaccaccaggacgtccagccgtcggtggcggcggtcagcctggacctcccggtttc
cccggagagagaggtcagaagggagacggtggtgctccaggcctctctttaccaggagcc
ccaggacgatctggatctcctggcagcccgggaccacaggggccccctggacctccaggc
ttttccagcagcgcacaaaactgcgtcgccggagaacccgggcgccccggtgtgcagggc
gagagaggttaccccggaaattcgggacagaaaggtgagaagggcgaaacctgcgtgaac
tgcttcaatgacatcagctcgatcccaggagagaaaggacttcctggaccacctggattc
ccaggtaatcctggcaacccgggtttgaaaggagacagaggatttccagggaatcccgga
agtgctggacccgctggtgcccccggccctcaaggttccgcaggattccccggagagaaa
ggtgatccaggtgatgccatcacagtccctggtgggcggggagagaagggtgacactggc
ttccctggaccccccggtcttcccggtctggacggtcgacctggtcgtgatggacaacct
ggatccccggggcccaaaggatcttctggctctctgctggtaaaaggagaacgaggaccc
cccggtgagccgggttctcctggtaatccaggagacaggggtccgccaggtggccccggc
tttggacctcaagggccttccggagaaaagggtatccagggcgtctctggaagacctgga
ggtcccggtgctcctggtgctaaaggtgaacctggcctgacagtggcagagaaaggttta
ccaggacccagaggacaggatggagagcctggacggcctggtccaccaggtgacgcaggt
cagtttggacagcctggtttccctggtttacccggagtgaagggtgaacctggcctccct
ggcatcggactccctggacccccaggatctaaaggattcccaggtatcccaggtcagcca
ggatctcctggaggaccaggcagaccaggagtagacggactctccggccagcctggaatt
cctggatccaagggtgaacctggcttcggacttcccggcccacctggtttacctggagta
cccggatctaaaggtttccccggaccaaagggagatcctggtttctctggtggccctggt
tcaccaggaagatctggatttgatggcaccccaggatccaaaggcgagcccggtttatct
ggtgtccctggagctcgtggcccaccgggatccccctccactggctcatttgggctccca
ggctcccctggagctccaggcccgatgggaccaccaggattccctggatcaaatggagag
aaaggtgaccccggtcctccaggtctagatatcccaggtttgccaggagatagaggaaat
cccggtttcccaggttctacaggaccagctggaaccccaggacctcctggagggcctgga
cgagatggtctgcctggattgccaggtcagaaaggtgacatgggtcccatgggatcccca
ggaccctccggaggaccgggaggcccaggaggacctggtgctcctggacttaaaggtgaa
cctgggttctcaggtcgagatggttctcctggtggttccggcattaaaggagaaaggggt
gaccccggtgtcgcaggacccccaggtcctaccctgacagcagcagccgtaaagggaacc
aaaggagattcaggacttccaggtggaccaggttttccaggtcagaaaggtgtcagcggt
ctccccggagacccaggacttccaggatcagatggtcgccctggactccccggaccacca
ggtccaaagggcgatgctggattcccaggaggcccgggaggacctggagctccaggacta
aaaggcagcatgggagaaatgggatttcctggaccagcagggcagaagggtctaccaggt
ctgtctgggcgaccaggaacctcaggacagccaggaggaccgggtttccccggagccaaa
ggtgaaccaggttctgccggagttgggccacctggaccacctggattcaagggtgagcca
ggtcagtcagggttcccaggaagtccaggactcaaaggagctccaggatcacctggtctc
tcaggtttacctggaagtccaggtaccaaaggtgatcctggccttcccggattccaaggt
tctcctggtatcccaggtccgaagggtcttgacggtggtcccggctccccaggtctcacc
ggatcaccaggtagaccaggagagcctggccgacctggagcatcaggttttccaggagat
aagggtcaggcaggtcgtgatggaatcccaggaccggctggagtcaagggagagcccggg
cttcctggtcacggagcccctggtgcctctgggcttccagggtttccaggtgcaaaggga
gacccaggtcttcccggtccctctggcagccccggtttccccggctctaaaggagaagct
ggcttccctggttcccctggtccttcaggaaacagtggccctcctggccctcctggactg
gctgtgcagggccccaaaggactccaaggtccccctggacctcctggacgagcaggtccc
tcaggtcctccaggtccaggcggcccgcagggtccccgcggacctgcaggaagtggcggc
gttaagggagagaagggtattcccggcgctcctggccagcccggcttctctggacagaag
ggagagtctggtgttccaggattcccgggtacctctggtgttcctggcggctctggtata
aagggagacatcggtctgcctggcgttcctggattcccgggacccaagggagacccagga
attagcggtagtaatggtcttcctggagatcctggagacattgggcctgtcggccctcct
ggtgaccctggtttatctccgactcccatcgtggtgaagggagagcgaggacctcctgga
cctcagggccagcaaggtggccagggactgcctggttcttctggacgtgatgggctgcca
ggtcaacctggtaaccctggagatcctggtaccgagggccctcccggcttcagcggccca
cccggcaggaaaggagacacaggacccgccggtcagcctggtcagcgaggttaccctggt
ccccctggttcagacggtccacagggtcagcctggtctcccaggaacagcctctgcggcc
cacggcttcctcatcacccgacacagccagggtacggaggtgccctactgtcccgacgga
acaagcagcatctacgacggttactcgctgctgtacgtgcagggcaacgagagggctcac
gggcaggaccttggcacggctggcagctgtctccgcaggttcagcaccatgcccttcatg
ttctgcaacatcaacaacgtctgcaacttcgcctcccgaaacgactactcctactggctg
tccacgcccgagcccatgcccatgtccatggacccgctcagaggggagagcatcaagcct
ttcatcagcaggtgttcagtgtgtgaagctccagccatggtgatagcagtgcacagtcag
accatccagattccatcgtgcccagggaactgggaagctctgtggatcggatactccttc
atgatgcacaccagtgcaggtgcagagggctccggtcaggccctggcctctcccggctcc
tgcctggaggagttccgcagcgctcccttcatcgagtgccacggcagcggcacctgcaac
tactacggcaactcctactccttctggctggccactgtggaaccctctgagatgttcagg
aagccacagtcggagactctcaaggcggggaacctacggacgcgcgtcagccgttgcgtg
gtctgcatgaagaggacgtaa

DBGET integrated database retrieval system