KEGG   Paralichthys olivaceus (Japanese flounder): 109642994
Entry
109642994         CDS       T06037                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like isoform X1
  KO
K04503  G1/S-specific cyclin-D1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04068  FoxO signaling pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04218  Cellular senescence
pov04310  Wnt signaling pathway
pov04340  Hedgehog signaling pathway
pov04371  Apelin signaling pathway
pov04510  Focal adhesion
pov04530  Tight junction
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109642994
   04340 Hedgehog signaling pathway
    109642994
   04371 Apelin signaling pathway
    109642994
   04068 FoxO signaling pathway
    109642994
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109642994
   04115 p53 signaling pathway
    109642994
   04218 Cellular senescence
    109642994
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109642994
   04530 Tight junction
    109642994
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109642994
NCBI-ProteinID: XP_019963534
LinkDB
Position
Unknown
AA seq 304 aa
MTQSATDRVKDMESLLLCREADRPARAYRDSNLLTDRVLRALLRAQDKYLPASNYFKCVQ
REIVPYMRRIVAIWVLEVCEEQRCEEEVFPLAMNYIDRFLSVEPTKKNDLQLLGAACMFL
ASKLRKTIPLTAEKLCIYTDNSITPTQLMQMELLVLNKLKWDLASVTPLDFIDHFLSQLP
VSRESRTILRKHAQTFAKLCATDNKFIASPPSMVAAGSMVAAVEGLQIKMVGNALMAQKL
TEQLAQTIRSDSDCLRACQEQIELLLENSLRQAQQQNSVAVETKNIGERQDLSTTPTDVC
DINI
NT seq 915 nt   +upstreamnt  +downstreamnt
atgacacaaagcgccacagacagggtgaaagacatggagtctctgcttctgtgccgtgag
gcggacaggcctgccagggcttaccgggactccaacctgttgactgaccgggtcctgcgt
gcgctcctgcgagctcaagacaagtacctcccagcttccaactatttcaaatgcgtccag
agagaaatagttccgtacatgaggaggatagtggctatctgggtgttggaggtgtgtgag
gagcaaagatgtgaggaggaagttttcccactggctatgaactacatagaccgcttcctg
tcagtggaacccaccaagaagaacgatcttcagttattgggagctgcctgtatgttcctg
gcatccaaactgaggaagacaatcccactcactgctgagaaactctgcatctacacagac
aactctattacacctactcagctgatgcaaatggagttactggttttgaacaaactcaaa
tgggacctggcttcagtaaccccccttgacttcatcgaccacttcctgtcccagctgcct
gtcagtagagagagcaggaccatactcaggaagcacgctcagacctttgcaaagctgtgt
gccacagataataaattcatagccagccctccatccatggtagcagcaggcagcatggtg
gcagcagtggagggcttacagataaaaatggtgggaaatgccttgatggcacagaaactg
acagagcaacttgcacaaaccatcaggagtgactcagactgccttcgagcatgtcaggaa
caaattgagctgttgctggaaaacagtctcagacaggcacaacagcaaaactctgttgct
gtggaaactaagaacattggcgagaggcaggacctctcaactacccccacagatgtctgt
gacataaacatctga

DBGET integrated database retrieval system