KEGG   Paralichthys olivaceus (Japanese flounder): 109643127
Entry
109643127         CDS       T06037                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109643127 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109643127 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pov04052]
    109643127 (kitlg)
Cytokines and growth factors [BR:pov04052]
 Growth factors
  Growth factors (RTK binding)
   109643127 (kitlg)
SSDB
Motif
Pfam: SCF DASH_Dad4 CcmD
Other DBs
NCBI-GeneID: 109643127
NCBI-ProteinID: XP_019963707
LinkDB
Position
Unknown
AA seq 264 aa
WIRVCVYLLLFITLGVHSSKIDVNPVTDDISRLSVLRQNIPKDYKIPVHFVPKEEGGMCW
VKLNVFYLEESLKDLAHKFGNISSNRKDISIFIQMLQELRLNMGSLEPIMYDFECHYREE
RWQTARYFDFVKDFLIAAQNREDSDDCNPPPCPTTPYTVTSEEYLEASPTSSSKGSDCTT
GCNPLPNQGERLLPEVVERSLLSLLFIPLLGLVFLIVWKVRSRRNELAPQQNPGAGAIFT
GTEWTAPPLDEISEKNKLNVIETV
NT seq 795 nt   +upstreamnt  +downstreamnt
tggatacgtgtctgtgtctatttactgctgttcatcactcttggggtacattcaagtaaa
attgacgtcaacccagtgacagatgacatctctaggctctctgttttgagacaaaatatt
cctaaagattacaaaattcctgtacattttgttcctaaagaagagggtgggatgtgttgg
gtaaaattaaacgtcttctacttggaggagagtttaaaagatttagcgcataagtttgga
aacatttcatccaacagaaaagatattagcatattcatccaaatgctccaagaactgcgg
ctcaacatggggtctctggagccgatcatgtacgattttgagtgccactacagggaagag
aggtggcagacagcgcgatactttgactttgtcaaagacttccttatagctgcacagaat
agagaagattcagatgactgtaatcctcctccctgtcccacgacaccatacacagtaact
tcagaagaatatttagaagcatcacccacgtccagcagcaaaggctcagactgtacgaca
ggctgcaatccacttccaaatcaaggagagagattgctgcctgaggtggtggagcgaagc
cttctctccttactcttcatcccactcttaggccttgtattcctgatcgtgtggaaggtc
cgatcacggaggaacgagctggctcctcaacagaaccccggagcaggggcaatcttcaca
ggaacagaatggactgcacctccactggatgaaatatcagaaaaaaacaagttgaacgtc
attgaaactgtgtaa

DBGET integrated database retrieval system