KEGG   Paralichthys olivaceus (Japanese flounder): 109643735
Entry
109643735         CDS       T06037                                 

Gene name
mdm2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04068  FoxO signaling pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04120  Ubiquitin mediated proteolysis
pov04144  Endocytosis
pov04218  Cellular senescence
pov04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109643735 (mdm2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109643735 (mdm2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109643735 (mdm2)
  09143 Cell growth and death
   04110 Cell cycle
    109643735 (mdm2)
   04115 p53 signaling pathway
    109643735 (mdm2)
   04218 Cellular senescence
    109643735 (mdm2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109643735 (mdm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pov04131]
    109643735 (mdm2)
   04121 Ubiquitin system [BR:pov04121]
    109643735 (mdm2)
Enzymes [BR:pov01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     109643735 (mdm2)
Membrane trafficking [BR:pov04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    109643735 (mdm2)
Ubiquitin system [BR:pov04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    109643735 (mdm2)
SSDB
Motif
Pfam: SWIB zf-RanBP Rox3
Other DBs
NCBI-GeneID: 109643735
NCBI-ProteinID: XP_019964494
LinkDB
Position
Unknown
AA seq 497 aa
MSADSELSTDTSDDNKLVKPKVEFRSLLQHAGATKDVFTMKEVMFYLGQYIIQNQLYDQK
QQHIVQCSHDALGRVLGVDSFSVKEPRVLFAMITKNLVAVKSQESPPSENEPNGNSQTDR
GTEEAESESRSSSPDRRKRRRRRGRRRRSCRSNEPGPSHSVEDDEDEEESEDEEEEEGRK
RRRSDSFSFTFDDSLSWCVIGGLGGKRDRHSSQSSESHSTSGRSEVTVPASDSESDNFSV
EFEVESADSDDYNEDDTSLSADDQVYEVTIFEAEDDDSFDEDTEITEADYWRCVKCDELN
PPLPRNCLRCWTLRRDWLPEESLNATNSSPSSPKALPKKPTDQSAAKEASGTFSCSIRSR
VRIISDELSMIQQTEVPMSRRTKESMFQMGKGRELLLCRSVSLTAPPPLPTPRISSPPPS
PPPPTPPRTPRSFSSRPSHVHLLLLRSQSWSAACLRSGVCQSRASTPASSVSPGPRTAAS
STDERDTSCPATSAPGS
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgtcagctgacagcgagctgagcaccgacaccagtgacgacaacaaactggtcaaacca
aaagtggagttccgctctctgctgcaacatgctggggccacaaaagatgttttcaccatg
aaggaggtgatgttctacctgggtcagtacatcatccagaaccagctgtacgaccagaag
cagcagcacatcgtccaatgctcccatgatgcactggggcgggtgctgggagtcgacagc
ttctctgtgaaagagccacgagttctgtttgcaatgatcaccaagaacctggtggctgtg
aagagccaagagtcgcccccgagcgagaacgaaccaaacggcaacagtcagacagacaga
gggacagaggaggcagaatcagaaagccgctcttcatcaccagacaggaggaagaggagg
agaaggagggggaggagaaggaggagctgcaggagcaatgaaccaggcccctcccacagt
gttgaggatgatgaagatgaggaggagtcagaggatgaagaggaagaagaggggaggaag
aggaggagatccgacagcttctcctttacctttgatgacagcttgtcctggtgtgtgatt
ggaggactgggcggcaagcgggacagacacagcagtcaatcatcagaatcacacagcaca
tctgggaggtcagaggtcacggtcccagcctcagactcagagagcgacaacttcagcgtc
gaatttgaggtcgagtccgcagattccgacgattacaatgaagacgacacttctctgtcg
gccgacgaccaggtgtacgaggtcaccatctttgaggcagaagacgacgactccttcgat
gaagacacagaaatcactgaagctgactactggcggtgtgtgaagtgtgacgagttgaac
ccccccctccctagaaactgtctccgctgttggactctgcgacgcgattggctgcctgag
gagtccctcaacgctactaactcctccccctccagtcctaaagcactgcccaaaaagcca
accgaccaatcggcagccaaagaagcttcaggtacctttagttgcagcatcaggtcacga
gttcgtatcatatctgacgagttatcaatgattcaacagacagaggttccgatgtcgagg
agaacgaaggagtcgatgttccagatgggaaaagggcgagaactcctcctctgtcgcagt
gtttctctgactgcacctcctccgctcccaactcccaggatctcctctcctcctcccagc
cctcctcctcctactcctccacggactcccaggagcttctccagtcgtccctcacatgtt
cacctcctgctcctgcggtcccagagttggagcgcagcgtgtctgcggagtggcgtttgc
cagagtcgtgcctcgacccctgcctcatctgtcagtcccggcccaagaacggctgcatcg
tccacggacgaacgggacacctcatgtcctgctacgtctgcgccaggaagctga

DBGET integrated database retrieval system