KEGG   Paralichthys olivaceus (Japanese flounder): 109644160
Entry
109644160         CDS       T06037                                 

Gene name
perp
Definition
(RefSeq) p53 apoptosis effector related to PMP-22
  KO
K10136  TP53 apoptosis effector
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109644160 (perp)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_3 Clc-like Claudin_2 Amastin
Other DBs
NCBI-GeneID: 109644160
NCBI-ProteinID: XP_019965049
LinkDB
Position
Unknown
AA seq 185 aa
MFRCGIAYPRCRWIVPLLLLFAIIFDIIAIAASSGWVEDEDAKSHYASMWEQCRGRNEHW
QCKSLMEFPWAQAVAALMIIGLIILIIAFIISCVALCCSLNLSLMPLIAIMLIVVVVLQV
IALIIYPVKFNEQIFEGHYYYTWAYGFGWGATILCIGCSILFCCLPRYEDELSGLAKAKY
IYQST
NT seq 558 nt   +upstreamnt  +downstreamnt
atgttccgctgcgggatcgcctacccccggtgcaggtggatcgtccccctgctgctgctc
ttcgccattattttcgacataatcgccatcgccgccagctccgggtgggtggaggacgag
gacgccaagtcgcactacgccagcatgtgggagcagtgccggggcaggaacgagcactgg
cagtgcaagtcgctcatggagttcccttgggcccaggctgtggctgctctgatgatcatc
ggcctcatcatcctcatcatcgccttcatcatctcctgcgtggctctgtgctgctcactc
aacttgagccttatgcccctcatagcaataatgttgattgttgtcgtggtcctccaggtc
atcgctctcatcatctaccccgtcaaattcaacgagcagatctttgagggccactactac
tacacctgggcctacggcttcggctggggcgccaccatcctctgcatcggatgcagcatc
ctcttctgctgcctgccgcgctatgaggacgagctgtccggcctggctaaggccaaatac
atctaccagtccacttag

DBGET integrated database retrieval system