KEGG   Paralichthys olivaceus (Japanese flounder): 109644251
Entry
109644251         CDS       T06037                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type IV-like
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04020  Calcium signaling pathway
pov04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109644251
   04020 Calcium signaling pathway
    109644251
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109644251
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     109644251
Protein kinases [BR:pov01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   109644251
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr FTA2 Kinase-like Kdo RIO1 YrbL-PhoP_reg PACT_coil_coil
Other DBs
NCBI-GeneID: 109644251
NCBI-ProteinID: XP_019965158
LinkDB
Position
Unknown
AA seq 433 aa
MPTSRPGSEPMEFWVEGSRRDGTVEEFYTLSSELGRGATSVVYRCEEKQTQKLYAVKVLK
KTIDKKIVRTEIGVLLRLSHPNIIQLKEIFETDTDIALVLELVTGGELFDRIVERGYYSE
RDAAHVIKQILEAVAYLHEHGVVHRDLKPENLLYADLSLDAPLKIADFGLSKIIDDQVTM
KTVCGTPGYCAPEILRGNAYGPEVDMWSVGVILVSKLIVLDPQKRLSVREALQHPWVLGK
AARFSHMDTTQRKLQEFNARRKLKAAMKAVVATSRMHEGSRRRTDSCEIPSSGASRQSSM
QQDPPPDSTDPTPSDKEPPPSDQQPQDDESDPTDKSALSPLSPRVLKSPSSDVTPTDAAP
TRPPLRADGLRQMSVSPKTVLVQPPLQQKSCSMVEPTSGVEATPVRATPPCPNSLTNGFT
PGAEPANQMPHCQ
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgccgacgtcccggcctggttctgagccgatggagttctgggtggagggttcgaggcgg
gacgggacggtggaggagttctacaccttgagctccgagctgggcagaggagccacgtcc
gttgtttatcgctgtgaagagaaacagactcagaaactctacgctgtcaaagtcctcaaa
aaaacgatcgacaagaaaattgttcgtacagaaatcggagtcttgctgcgtctgtctcat
ccaaacatcatccagctgaaggagatctttgagacggacactgacatcgctctggtgctg
gagctggtgactggaggagagctgtttgacaggattgtggagagaggttactacagcgag
agagacgccgctcacgtcatcaaacaaatcctggaggctgtggcatatttacatgaacat
ggcgtggtgcatcgtgacctgaaaccagagaacctgctgtacgccgacctgtcactggac
gctccgctcaagatagccgactttggtctctccaaaatcatcgatgaccaagtcaccatg
aagacggtctgtggtaccccaggatactgcgctccagagattctgaggggaaacgcctac
ggacctgaagtggacatgtggtcagtgggtgtcatcctcgtcagcaagctgatcgtcctt
gaccctcagaagcgcctcagtgtccgggaggctctgcagcacccctgggtgctgggtaaa
gccgcccgcttctcccacatggacaccactcagaggaaactacaggagttcaatgctcga
cgtaagctcaaggctgctatgaaggctgtcgttgccaccagccgcatgcacgagggatcg
cgacgtcgtaccgacagctgtgaaattccaagctcaggggcttccaggcagagcagcatg
cagcaggacccgccccctgattccacagaccccaccccttcagacaaagaacccccgccc
tcagatcaacagccacaggatgacgaatcagatcccaccgacaaaagtgctctcagcccc
ttgtctccacgcgttctcaaatcccccagctccgatgtcacgcccacagacgccgccccc
accaggccgccattgcgagccgacgggctgcggcagatgtctgtcagtcctaaaactgtg
ctggtccaacccccactgcagcaaaagagctgctccatggtagagcccacctctggagtc
gaggccacgcctgtgagggccacgcccccgtgtcccaacagcctcactaatggcttcaca
ccaggggcggagccagccaatcagatgccccactgccagtga

DBGET integrated database retrieval system