KEGG   Paralichthys olivaceus (Japanese flounder): 109644696
Entry
109644696         CDS       T06037                                 

Gene name
gorab
Definition
(RefSeq) RAB6-interacting golgin
  KO
K19748  RAB6-interacting golgin
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109644696 (gorab)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pov04131]
    109644696 (gorab)
Membrane trafficking [BR:pov04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    109644696 (gorab)
SSDB
Motif
Pfam: Transcrip_act DUF1127
Other DBs
NCBI-GeneID: 109644696
NCBI-ProteinID: XP_019965694
LinkDB
Position
Unknown
AA seq 373 aa
MSGWAGFSDEELRRMQLNDSAGSAGAARGRKPAPANRTRQQLLRERALQLAAQKATGAGS
SGLPPEQQLTKPPPKEQPPAVAPAGAPAPAGAPAGAPAVRQEAQPKSSEVKQIENHQPTA
EEQTPAVKELEKQEVELREKSRLEQLQQEQKVMEEGNKRKKALLAKTIAEKSKQTQAEAV
KLKRIQKELQALDDMVSNDIGILREKIEQASWSYTAARKRYEKAEAEYVTAKLDLHKKTE
VKEQMTEHLCAIIQQNELRKAHKLEELMQQLHLQATEEELERQKEEEEEEEEKKTRRSCA
EMQRNGKEGNGLVAKQEGAVQSPEDSKPTEEESVKEERGGDVQGESKTMSEPPETKQDCD
TLENGVQSEPVVS
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgagcggctgggccggtttttctgacgaggagctgcggaggatgcagctgaacgactcg
gccgggtccgcaggggcagcccgcgggcggaagccggctccagccaaccggacccggcag
cagttactgcgggagagagcccttcagctcgccgctcagaaagccacaggagccgggagc
tccggcctgcccccggagcagcaactcaccaagccgccgccgaaagaacagccaccggcc
gtggctccagccggagctccggctccagcaggagctccggctggagctccggctgtcaga
caagaagctcagccgaagtccagcgaggtgaagcagattgaaaaccatcagccgaccgca
gaggagcaaaccccggctgtgaaagagctggagaaacaagaggtggaactacgagagaag
tcgcgtctggagcagctgcagcaagaacagaaagtcatggaagaggggaataaacgcaag
aaagctctgctggcaaaaactatagctgagaagtccaaacagactcaggcagaagctgtg
aagctgaagaggatccagaaggagctccaggcccttgacgacatggtgtccaatgatatc
ggcatcctgagagaaaagatagaacaggccagctggagctacaccgccgccaggaaacgc
tacgagaaggcagaggccgagtacgtgacggccaagctggacctgcacaagaagacggag
gtgaaggagcagatgacggagcacctctgtgccatcatccagcagaacgagctgcgtaaa
gcccacaagctggaggagctgatgcagcagcttcatctccaggctaccgaggaggagctg
gagaggcagaaagaggaggaagaggaggaggaggagaagaagacgaggagaagctgtgcg
gagatgcagagaaacgggaaggagggtaatggtttagtggcgaagcaggaaggagcagtg
caatcacccgaagactctaaaccgacagaggaggagagtgtgaaggaggagagaggaggt
gacgtccagggagagtccaaaacaatgagtgaaccaccagagaccaaacaggactgtgac
acattagagaacggcgtccagagcgagccggtggtgtcctga

DBGET integrated database retrieval system