KEGG   Paralichthys olivaceus (Japanese flounder): 109644750Help
Entry
109644750         CDS       T06037                                 

Gene name
nit1
Definition
(RefSeq) nitrilase homolog 1
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Brite
KEGG Orthology (KO) [BR:pov00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109644750 (nit1)
Enzymes [BR:pov01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     109644750 (nit1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 109644750
NCBI-ProteinID: XP_019965755
LinkDB All DBs
Position
Unknown
AA seq 286 aa AA seqDB search
MSAAPHSMAAVCQVTSTPDKQANFSACKRLAEEAKERGAGMVFLPEGFDYIGSSREETLS
LSEPLTGDTISRYAQLARKLEVWLSLGGFHERGPEWERDRRIYNSHIIMNDKGDIVSVYR
KSHLFDVELPEKGVSLRESGFTIPGPVLVSPVQTPIGKLGLGICYDLRFPELSLALRRHG
ADVLTYPSAFTVATGAAHWEVLLRARAIETQCFVLAAAQVGRHHEKRSSYGHALAVDPWG
EVLGDCGGESPGMVLVKINLDQVSSTRRNMPVQQHRRDTGFYLSLE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcggcgcctcactcgatggctgcggtctgtcaggtgacgtccacccccgacaaa
caggccaacttctctgcctgtaaacggttggcggaggaggccaaggagcgaggggccggc
atggtcttcctgcccgagggcttcgactacatcggatccagtcgagaggagacgctgtcg
ctgtctgagcccctgacaggagacaccatctcccgatacgctcagttagccaggaagctg
gaggtgtggctgtctctcggagggtttcatgaacgaggacctgagtgggagagggacaga
cgaatctacaacagtcacatcataatgaatgataaaggggacattgtgtccgtctacagg
aagtcccatttgtttgatgtggagctgccagaaaaaggtgtgtccctcagagaaagtggc
ttcaccatccctggacccgtcctcgtgtctccggtgcaaactcccatcggcaagcttggt
ttgggaatctgctacgacctgagatttcctgagttatctctggccctgcggcggcacggg
gccgacgtcctgacgtatccatccgccttcactgtagccacaggagcggctcactgggag
gtgttactgcgtgcacgagctatcgagacccagtgctttgtcttggccgcagctcaggtc
ggtcggcaccacgagaagcgctcgtcgtacggccacgccctcgcagtggacccctggggc
gaggtgctgggcgactgcggaggcgagagtcctggcatggtgctcgtgaagatcaacctg
gaccaagtgagcagcactcggagaaacatgccggtccaacagcaccgcagagacacgggc
ttctatctcagtctggagtag

DBGET integrated database retrieval system