KEGG   Paralichthys olivaceus (Japanese flounder): 109645500
Entry
109645500         CDS       T06037                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109645500
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109645500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pov04052]
    109645500
   00536 Glycosaminoglycan binding proteins [BR:pov00536]
    109645500
Cytokines and growth factors [BR:pov04052]
 Growth factors
  Growth factors (RTK binding)
   109645500
Glycosaminoglycan binding proteins [BR:pov00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   109645500
SSDB
Motif
Pfam: FGF Fascin Ntox17
Other DBs
NCBI-GeneID: 109645500
NCBI-ProteinID: XP_019966709
LinkDB
Position
Unknown
AA seq 156 aa
MADGEMFALEENQAVEAGPRDHRRLTRLYCMNGGHHLQILPDGTVQGRREDGDAHTVLKI
KSVDRGVVVIQGTEAERYLAMSDEGRLYSSPTVSDESYFLEKLEENHYNTYRPQKQRERN
WYVALKKNGKPKLGPRTHIGQKAVFFLPRQLDSSGE
NT seq 471 nt   +upstreamnt  +downstreamnt
atggcggatggagaaatgttcgcattggaggagaaccaggctgtggaggcgggaccgcgg
gaccacaggaggctgacccgactttactgcatgaacggcggacaccacctgcagatcctg
cccgatgggacggtgcagggccggagggaggatggagacgctcacactgttttaaagatc
aaatcagtggacagaggagtggtggtcatccaggggacagaggctgagcgatatctggca
atgagcgatgagggacgtctgtacagttcacccacagtctctgatgagtcgtacttcctg
gagaaactggaggagaatcactacaacacatatcggcctcagaagcaacgggagaggaac
tggtatgtggctctgaaaaagaacggaaaacctaaactgggtccaagaactcacattggg
cagaaggccgtcttctttctgccccgccagctggacagctctggggagtag

DBGET integrated database retrieval system