KEGG   Paralichthys olivaceus (Japanese flounder): 109645737Help
Entry
109645737         CDS       T06037                                 

Definition
(RefSeq) histone-lysine N-methyltransferase Smyd1-like
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov00310  Lysine degradation
pov01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pov00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109645737
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pov03036]
    109645737
Enzymes [BR:pov01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     109645737
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     109645737
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109645737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Caprin-1_dimer
Motif
Other DBs
NCBI-GeneID: 109645737
NCBI-ProteinID: XP_019966931
LinkDB All DBs
Position
Unknown
AA seq 298 aa AA seqDB search
LQIKCNGFTLSDQRGLQAVGVGLFPNLCLVNHDCWPNCTVILNHGNQSALSSALHSQRRI
ELRVLEKIPEGVELTVSYVDFLNLSADRQKKLKEHFHFECTCEHCSHHTKDDLMMAAAEG
SKADKVKEVTAFSQDCLEKIEASRVQGDFRHVVKLCCECLEKQENVLADTHLYKLQVLSV
ASEVLSYLHSFSEAADYAHRMVEGYTKLYHPNNAQLGMAIMRAGVTHWHAGQIEAGHRMI
CTAYGILMVTHGPNHAITRDLETMRAQTEAELKMFRQNELKYHTMRDAALKIQPTASC
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ctgcagatcaagtgtaatggattcactctgagtgatcagagaggtctgcaggctgttggt
gtgggtctgtttccaaacctgtgtctggtgaaccacgactgttggcccaactgcaccgtc
atcctcaaccacggcaaccaatcggctctgagttctgctctccattctcagaggagaatc
gagctgcgagttctggagaaaatcccagagggcgtcgagctgaccgtcagctacgtggac
ttcctcaacctgtccgccgaccgccagaagaagctcaaggagcatttccactttgagtgc
acctgcgagcactgcagccatcacaccaaggacgacctgatgatggctgcggccgaggga
agcaaagccgataaagtgaaggaggtgacggccttcagtcaagattgtctggagaagatc
gaggcgtctcgtgttcagggcgattttcgccacgtggtgaagctgtgttgtgaatgtctg
gagaagcaggagaacgttctggccgacactcacctctacaagctgcaggtgctcagcgtc
gccagcgaggttctgtcgtacctgcattcgttctctgaggctgcggactacgcccacagg
atggtggagggatacacgaagttgtatcaccctaacaacgcccagttgggcatggccatc
atgcgggcgggcgtcacccactggcacgctggtcagatcgaggcgggccacagaatgatc
tgcacggcctacgggatcctcatggtcacacatggaccgaaccacgccatcaccagagac
ctggagaccatgcgtgcgcagacggaggcggagctgaagatgttcaggcagaacgagctg
aagtaccacaccatgagggacgccgctctgaagatccagcccacggcctcgtgttaa

DBGET integrated database retrieval system