KEGG   Paralichthys olivaceus (Japanese flounder): 109645876
Entry
109645876         CDS       T06037                                 

Gene name
atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04141  Protein processing in endoplasmic reticulum
pov04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:pov00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109645876 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109645876 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pov03000]
    109645876 (atf6b)
Transcription factors [BR:pov03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    109645876 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf YabA DUF4140 MCU HAUS6_N CENP-H
Other DBs
NCBI-GeneID: 109645876
NCBI-ProteinID: XP_019967105
LinkDB
Position
Unknown
AA seq 610 aa
MSTDLLSELDTRFFADNLLTSEDWDACLYQCESMEEGEDADFPRGLKYNTTFDNDLVLSL
NPDNPTSPWQHSDDNLLTGETSVTKNEMTITQPLPVEMLFQVKAEPLSPASSLSSDCSAS
SPDPQVTVKGENPPTPPYMYGDVLSPPLGSMEVTVATSAVPPPLQTQKSLTAQIPAAIGG
LQTQATVLPRSATLKTNNILSTKPPIQPRPLCVASRPVPQTPAPAKTLILQGLPPMDQTR
PVVLSQSVCLGSAPAIVKMEPVSPSITQHCSSPTAPPTSKPIVPATSTLPGNSSGDVDMK
VLKRQQRMIKNRESACQSRKKKKEYLQSLEAQLREAQQENERLRRENQALRERLAGKEGS
DSASNKRAVCVMAVLLFMTFSFGPVSITDRKLSTGPQDSVVWYTGRQLLEIGQQRPLPQQ
RQVKAAAQSPSRVEDKTETEEDGAEADRFAAESYHFRNLSDVFSDMKDLVLQDIDRYFTS
SDCRQFNRSESLRLADELRGWVHRHQIDRKKSGGKPKIAKKAKIAQKAQLRKTNFSRYLP
IQTHRSLESQLQVLPGPEVTYNDFLDAIDRREDTFYVVSFRRDHLLLPAISHNKTSRPKM
SLVMPAMSVN
NT seq 1831 nt   +upstreamnt  +downstreamnt
atgagcacggacttactctctgagctggacacccgcttcttcgctgataacctcctgacc
agcgaggactgggatgcctgcctgtaccagtgtgagagcatggaggagggggaggacgcc
gacttcccccgagggctgaaatacaacacgacgtttgacaacgacctcgtgctctccctc
aatcctgacaaccccacatcaccatggcaacacagtgacgacaacctgctcacaggagaa
acatcggtaacaaaaaatgaaatgacgataactcagccgctaccagtggaaatgttgttc
caggtgaaagcagagcctctctccccggcgtcttcactctcctctgattgctccgcgtcc
tccccggaccctcaggtcacggttaaaggtgaaaaccctccgactcctccgtacatgtac
ggagacgtgctgtctcctccgctcggatccatggaggtgaccgtggccacgtcggccgtg
ccccccccactacagacacagaagtcgttgacggcccagatcccagcggccatcggtggg
ttacagacgcaggcgacagtgctgccgaggtccgccacgttaaagaccaacaacatcctg
agcacaaaaccccccatccagccccgacccctgtgtgtcgcctcccgccctgtcccccag
accccggcaccggctaagaccctcatactacagggcctcccccccatggaccagaccaga
cccgtcgtcctgtctcagtccgtctgtctcggttcagctccggccatcgtcaagatggag
ccggtctctccctccatcacccagcactgctccagtcccacagccccgcccaccagcaaa
cccatcgtcccggcaacctccactttacctggcaacagctccggggacgttgacatgaag
gtgctgaagcggcagcagaggatgataaagaaccgggagtctgcgtgccagtcgaggaag
aagaagaaggagtacctgcagagcctggaggctcagctgagggaggcgcagcaggagaac
gaacgactccgccgggagaaccaggcactgagggagagactggctgggaaagagggcagc
gactcagcgagtaacaaacgagccgtttgtgtcatggccgttctgctcttcatgaccttc
agctttggtcccgtcagcatcacggacaggaagctgtcgacgggcccacaggacagtgtg
gtgtggtatacaggacgacagctgctggagatcgggcaacagcgaccgctgccgcagcag
cggcaggtgaaggcggcggctcagtctccgagcagagtggaggacaagacagagacggag
gaggacggagcggaggcggacagattcgctgcagagtcgtatcatttcaggaacctgagc
gacgtcttcagcgacatgaaggacctggttcttcaggacatcgatcgttacttcacgtcc
tcagactgtcgacagttcaatcgctccgagtccctgaggttggcggacgagctgagaggt
tgggttcatcgacatcagatcgacaggaagaagtctggagggaaaccaaagattgctaag
aaggctaagatcgcccagaaagctcagctgaggaagacaaacttctccagatatctgccg
attcagacccatcgctccctcgagagtcagctgcaggtgcttcctggtcctgaggtcacg
tacaacgacttcctggacgccatcgaccgcagagaggacactttctacgtcgtctcgttc
cgacgggaccacctgctgttaccggccatcagccacaataaaaccagccgacccaaaatg
tctctggtgatgccggccatgtccgttaacg

DBGET integrated database retrieval system