KEGG   Paralichthys olivaceus (Japanese flounder): 109647473
Entry
109647473         CDS       T06037                                 

Gene name
aifm2
Definition
(RefSeq) apoptosis-inducing factor 2
  KO
K22745  apoptosis-inducing factor 2
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109647473 (aifm2)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox GIDA Pyr_redox_3 DAO Lycopene_cycl NAD_binding_8 Thi4 NAD_binding_9 K_oxygenase FAD_oxidored AlaDh_PNT_C FAD_binding_2 TrkA_N HI0933_like Trp_halogenase FAD_binding_3 Peptidase_S28 DUF4147
Other DBs
NCBI-GeneID: 109647473
NCBI-ProteinID: XP_019968838
LinkDB
Position
Unknown
AA seq 203 aa
MGGQVSSVDGVHVVVVGGGFGGVAAAQQLKSQALNFTLIDMRDAFHHNVASLRASVQPGF
ARRTFIPFADTFGDSFVQGRVERVDINRQTVVLQGGREVQFSHLILCTGTDGPFPGKFNT
EASYQSSVQTYEDFTKQVQAADSVVVVGGGSTGVEMAAEIKTEHPEKKVVLIHSRIALAD
PELLPSVRHQAKEVLLQKGVELL
NT seq 609 nt   +upstreamnt  +downstreamnt
atgggcggtcaggtgtcgtcagtggacggcgtgcacgtcgtagttgtgggcggaggcttt
ggaggcgtggcggcggctcagcagctgaaatctcaggccctgaacttcaccctgatcgac
atgagagacgcttttcatcacaacgtggcgtcgctgcgagcttcggtgcagccgggcttc
gctcggagaaccttcatcccgttcgctgacacgttcggagacagttttgttcaaggtcga
gtggaacgagtcgacatcaacagacagacggtcgtcctgcagggggggagggaagtccag
ttctcccacctcatcctctgcaccggcactgacggaccgtttcctgggaagtttaacacg
gaggcgtcgtatcaaagcagcgttcagacttacgaggacttcactaagcaggtccaggct
gcagactcggtggtggtggtggggggggggtcgactggtgtggagatggctgctgagatc
aagacggagcatccagagaagaaggtggttctgattcactccaggatcgctctggccgac
cctgagctgctgcccagcgtccgacatcaggccaaagaagttctgctgcagaaaggagtg
gagctgctg

DBGET integrated database retrieval system