KEGG   Paralichthys olivaceus (Japanese flounder): 109648156
Entry
109648156         CDS       T06037                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
SSDB
Motif
Pfam: RA Nore1-SARAH DUF2989
Other DBs
NCBI-GeneID: 109648156
NCBI-ProteinID: XP_019969509
LinkDB
Position
Unknown
AA seq 184 aa
NKDGFYTGFIKVHFQLLRPISLPPPQSLCSTQDGDQQDRRMKRRTSFYLPKDTAKHLHIS
SQTRVREVIEALLNKFTVVDNPAKFALFERTERQGQVYTRKMSDDVCPLYLRLCAGPSEK
VLSLVLKENDTGDVNWDAFSFPELCNFLRILKREEEEHVRQIVKRYTLARERTKQAMARI
NTPA
NT seq 555 nt   +upstreamnt  +downstreamnt
aataaagacgggttctacactggtttcatcaaggtccactttcagttgcttcggccgatc
tccctccctcctcctcagagcctgtgctcgacacaagacggagatcagcaggacaggcgg
atgaaacggcggacatctttctacctccccaaagatactgcaaagcacctgcacataagc
tcacaaacacgggtacgggaagtcattgaggcactgctcaacaagttcactgtggtggac
aacccggccaagtttgccctgtttgaacgcactgaaagacaaggtcaagtgtacacgcgc
aaaatgtctgacgatgtctgtccactctacctacgcctgtgtgctggacccagtgagaaa
gtcctgagtctggttttgaaagaaaatgacactggggatgtcaattgggatgcgttcagc
tttcctgagctgtgcaactttttgcggatcctgaaacgagaagaagaggagcatgtccgg
cagattgtgaagcgttacactcttgcgagagaaaggacgaagcaggcgatggcgaggatt
aatacacctgcttga

DBGET integrated database retrieval system