KEGG   Paenibacillus sp. 32O-W: IJ21_08250Help
Entry
IJ21_08250        CDS       T04219                                 

Definition
(GenBank) 6-phospho 3-hexuloisomerase
  KO
K08094  6-phospho-3-hexuloisomerase [EC:5.3.1.27]
Organism
pow  Paenibacillus sp. 32O-W
Pathway
pow00030  Pentose phosphate pathway
pow00680  Methane metabolism
pow01100  Metabolic pathways
pow01120  Microbial metabolism in diverse environments
pow01200  Carbon metabolism
pow01230  Biosynthesis of amino acids
Module
pow_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:pow00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    IJ21_08250
  09102 Energy metabolism
   00680 Methane metabolism
    IJ21_08250
Enzymes [BR:pow01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.27  6-phospho-3-hexuloisomerase
     IJ21_08250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS SIS_2
Motif
Other DBs
NCBI-ProteinID: ALS26236
UniProt: A0A0U2UT46
LinkDB All DBs
Position
870524..871081
Genome map
AA seq 185 aa AA seqDB search
MRTVQFLAEVIEELHRSADFIAEDEAEKLVHAILESEKIFVAGAGRSGLMIRAFAMRLMQ
MGFDAYVVGETVTPNLDKNDLLIVGSGSGETKSLSFMAEKAKSLGAAVAVVTIFPESTIG
RLSDIVVKMPGSPKDKADGEYKTIQPMASLFEQTLLLFFDSVILKLMEKKGIESGTMFGR
HANLE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcggacggttcaatttttagccgaagtgattgaagaactgcaccggagcgcggacttc
atcgcagaggacgaagcggaaaagctggtccatgcgattctggagtcggagaaaatcttt
gtggccggtgcgggccgatccggtttgatgatccgggccttcgccatgcggctgatgcaa
atgggattcgacgcttacgtcgtaggcgaaacggtcacccccaacctggacaaaaacgac
ctgctcatcgtcgggtcgggttcgggcgagacgaaaagcttgagcttcatggccgagaaa
gcgaaaagcttgggcgcagcggttgccgttgtgacgatcttcccggagtcaacgatcgga
agactgtccgatattgtggtgaaaatgcccggctcgcccaaagacaaggcggacggagag
tacaaaacgatacagccgatggcttcgctgttcgaacaaacccttttgttgttctttgac
tccgtcatcttgaagctgatggagaaaaaagggatcgaatccggcacgatgttcggaaga
cacgcaaatctggagtaa

DBGET integrated database retrieval system