KEGG   Paenibacillus sp. 32O-W: IJ21_14040Help
Entry
IJ21_14040        CDS       T04219                                 

Definition
(GenBank) threonyl-tRNA synthetase
  KO
K01868  threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
pow  Paenibacillus sp. 32O-W
Pathway
pow00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pow00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    IJ21_14040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pow01007]
    IJ21_14040
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pow03016]
    IJ21_14040
Enzymes [BR:pow01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     IJ21_14040
Amino acid related enzymes [BR:pow01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   IJ21_14040
Transfer RNA biogenesis [BR:pow03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    IJ21_14040
 Prokaryotic type
    IJ21_14040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b HGTP_anticodon tRNA_SAD TGS tRNA-synt_His IceA2
Motif
Other DBs
NCBI-ProteinID: ALS26808
UniProt: A0A0U2ULF0
LinkDB All DBs
Position
1569417..1571354
Genome map
AA seq 645 aa AA seqDB search
MAIQVKLPDGAVREYEAGTTIEEVAGSISPGLRKNAIAGKVDGKIVDVYTPLDRDVSLEI
VTVDTPDGLEVYRHSTAHLMAQAIKRIYGPRSVKLGIGPVIEDGFYYDIDMEKSLTPDDL
EKIEQEMAKIVKEDLEIRRRVVSRAEALAIYEELGDELKLELIRDLPEDAVISIYDQGEF
FDLCRGPHLPSTGRIKAFKLLSVAGAYWRGDSKNKMLQRIYGTAFPKKSQLEEHLRLLEE
AKKRDHRKLGRELGIFTFSREVGQGLPLWLPNGAKVRRTMERYIVDLEERLGYDHVYTPV
LANVELYKTSGHWDHYQEDMFPVMAMDNEELVLRPMNCPHHMMVYKSELRSYRDLPIRIA
ELGTMHRYEMSGALTGLHRVRAMTLNDAHIFCRPDQIKDEFARVIQLIRQVYEDFGIKEY
RFRLSYRDPQDTEKYFPNDEMWEMSQRMLREVVEELGLPFFEAEGEAAFYGPKLDVQIKT
ALGKEETLSTAQLDFLLPERFELEYVGDDGKKHRPVVIHRGIISTMERMTAFLLENFAGA
LPLWLSPVQAKVIPVSTAYEDYARQVVEQLKRDGIRVEADLRNEKLGYKIREAQLEKVPY
MLVVGDNEAQNGTVSVRKRGEGDIGVRQVSELSAMLQEEIAAKTV
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggcaattcaggtgaagctgccggatggcgcagttcgggaatatgaggccggtacgacg
attgaggaagtggccggttcgatcagtccgggactgcgcaaaaacgcgatcgccggcaag
gtggacggcaaaatcgtggacgtctatacgccgctggaccgcgacgtatcgctcgagatt
gtgactgtcgacacgccggacggactggaagtgtaccggcacagcactgctcatctgatg
gcgcaggcgatcaagcgaatctacggcccccgctccgtgaagctgggcatcggcccggtt
atcgaggacggtttctactatgacatcgatatggaaaagtcgctcacgccggacgatctg
gagaagatcgagcaggaaatggcgaaaatcgtaaaagaggacctggaaatccggcggcgc
gtcgtctcgcgggccgaagcgctggcgatttacgaagagctcggcgacgagctgaagctg
gagctcattcgcgacttgccggaagacgcggtcatttcgatctatgatcaaggcgaattt
ttcgacttgtgccgcggtccccatttgccgtcgacgggccgcatcaaggcgttcaagctg
ctcagcgtcgccggcgcttattggcgcggcgattccaaaaacaaaatgctgcagcggatt
tacggcacggcgtttccgaagaaatcccagcttgaagagcatctgcgtctgctggaggaa
gcaaagaagcgggatcaccgcaagcttggccgggagctcggcatcttcaccttctcccgc
gaagttggtcagggactgccgctatggctgccgaacggcgcgaaggtgagacggacgatg
gagcgctatatcgtcgatctggaggagcgtctcggctacgatcatgtgtatacgccggta
ctggcgaatgtggagctgtacaaaacgtccggacactgggaccactatcaggaggacatg
ttcccggtcatggcaatggacaatgaggagctcgtccttcgcccgatgaactgtccgcac
catatgatggtttacaagagcgagctgcgcagctatcgggatttgccgatccggatcgcc
gagctcggcacgatgcaccgctacgagatgtccggcgcgttgaccggcctgcaccgcgtc
cgcgcgatgacgctgaacgacgcgcatattttctgccgtccggatcagatcaaggacgaa
ttcgcccgcgtcatccagctgatccgccaggtgtacgaggatttcggcatcaaggaatac
cggttccggctgtcgtaccgcgatccgcaggatacggagaaatatttcccgaacgatgaa
atgtgggagatgtcgcagcggatgctgcgcgaagtcgtcgaagagctggggctgccgttc
ttcgaagcggaaggggaagcggcgttctacggtccgaagctggatgtgcagatcaagacc
gcgctcggcaaggaagagacgctgtcgacggctcaactcgactttcttcttccggaacgg
ttcgaactcgaatatgtcggcgatgacgggaagaaacaccggccggtcgtcattcaccgg
ggcattatcagcacgatggagcggatgacggcgttcctgctggaaaacttcgcgggggct
ctgcccttgtggctgtcgccggtgcaggcgaaagtgatcccggtatcgaccgcttacgaa
gattacgcccggcaagtcgtggagcagttgaagcgggacggcatccgggtcgaggccgat
ttgcgcaacgagaagctcggctataaaatccgcgaagctcagttggagaaagtgccttat
atgctggtcgtcggcgacaacgaagcgcagaacggcacggtatcggtgcgcaagcgggga
gaaggcgatatcggcgtccggcaagtttcggaattgtcggcgatgctgcaggaggagatt
gccgccaagacggtttag

DBGET integrated database retrieval system