KEGG   Paenibacillus sp. 32O-W: IJ21_20770Help
Entry
IJ21_20770        CDS       T04219                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pow  Paenibacillus sp. 32O-W
Brite
KEGG Orthology (KO) [BR:pow00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pow01001]
    IJ21_20770
Enzymes [BR:pow01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     IJ21_20770
Protein kinases [BR:pow01001]
 Serine/threonine kinases: Other
  Bacterial family
   IJ21_20770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like Kdo RIO1 Haspin_kinase KIND FTA2 YrbL-PhoP_reg Seadorna_VP7 YukC Pkinase_fungal Fructosamin_kin RuvA_C
Motif
Other DBs
NCBI-ProteinID: ALS27474
UniProt: A0A0U2LA76
LinkDB All DBs
Position
2304467..2306683
Genome map
AA seq 738 aa AA seqDB search
MIGQDLGGRYEIISRIGGGGMALVYKAHDILLNRRVAVKVLRSQFVHDEEFIRRFRREAQ
SAASLSHPNVVSIYDVGQQDDIHYIVMEYIEGHNLNEIIQERAPLQTEEAVRIAQQICDA
LEHAHQNQIIHRDIKPHNILIGKNGRVKVTDFGIARAVTSATITQAGSVVGSVHYFSPEH
AKGVSAGEQSDLYSLGVVLYQMLTGELPFHGESPISVALKHLQETFVEPRVVNPHIPQSV
ENIILRSMRKNPGERYTSAGEMLRDLETCLQPDRLNEPKLVFDNDAEADMDETRIMPAIG
GALRDSQPSSGARPTPAGAGAAGAAGATGTAGAAPVQDEEPDEPSAAAQPKKKWVRPVVT
VSVTLVIIALVFWGVRTVLAILDVPEVEVPYVVGQTEDEARKMLQDAGLRVEEPPVKEHR
DDVENGIVFDQSKSNMRVKEGALIQLWVSLGPRMEEMPSFAESSYGDAVEALRALGVPEA
NIKKQEEHSDTDPGTVINQSPAAGEQFDPKKTNVTLTVSKGPATFKMPDLRGKNEEQARS
QLQALGLRLTGDEVVYEPSFTVPKGEVMEQYPYAPGAEVTKNAEVTLTVSSGPPKDAIEY
TYNVVISPAEVGGTSEVHIVYSDARGENIDWGTKKINNTKTFQVKLVLVPNTEATVTIER
DGVFMDSSSITYDEAVSGEHPGTVFIPGFEMSNGFFQDETPPDGEQPENGETDDGERGRD
EDRGRGKRDNRDGENGEP
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgatcgggcaggacttgggtggaaggtacgaaatcatctcccgcatcggcgggggcggc
atggcgctcgtctacaaggcgcacgacattttgttaaaccgccgtgttgcagttaaagta
ttgcgttcgcagttcgtacacgacgaagaatttatccggcgtttccgccgcgaagcgcag
tccgccgcatcgctgtcgcatcccaatgtcgtcagcatctacgatgtggggcagcaggac
gatatccattatatcgtcatggaatatatcgaaggtcataatctcaatgaaatcatccag
gaacgtgcgccgctccagacggaggaggcggtgcgcatcgcgcagcaaatttgcgacgcg
ctcgaacatgcgcaccagaaccagatcatccaccgcgatatcaagccgcacaacatattg
atcggcaagaacggccgggtcaaagtgaccgacttcggcattgcccgcgcggtgacgtcg
gccacgattacgcaagccggttcggtcgtcggctccgtgcactatttctcgccggagcat
gccaaaggggtcagcgcgggagagcagtcggacctgtactcgcttggcgtcgtactgtat
cagatgctgacaggcgagctgcccttccacggggaaagcccgatcagcgtggcgcttaaa
catttgcaggagacgttcgtggagccccgcgtcgtcaacccgcacattccgcaaagcgtg
gaaaatattattttgcgctcgatgcgcaaaaatcccggcgagcgctacacgtcggccggc
gaaatgctgcgcgatctggaaacgtgcctgcagccggaccggctgaacgagcccaaactc
gtcttcgacaacgacgccgaagcggatatggatgaaacgcgcatcatgccggccatcgga
ggcgcgctgcgcgattcgcaaccgtcgtccggcgcgcggccgacgccggcaggcgcaggc
gctgcgggcgccgcgggagccacgggcactgcgggcgctgcgcccgttcaggacgaagag
ccggacgaaccgtctgccgccgcgcagccgaagaagaaatgggtgcgtcccgtcgtgacc
gtatcggtaacgctcgtcatcatcgcgctcgtgttttggggcgttcgcaccgtgctggcg
attctcgacgtgccggaggtggaagtcccgtacgtcgtcggccaaacggaggacgaagcc
cgcaaaatgctgcaagacgccggcctgcgcgttgaggagccgcccgttaaggagcatcgg
gacgacgtcgagaacggcatcgtgttcgaccagtccaaatcgaacatgcgggtcaaggaa
ggcgcgcttatccagctgtgggtcagcttgggaccgcgcatggaagaaatgccgtccttc
gcggagtcgtcttacggcgatgcggtggaagctttgcgggcgctcggcgtgcctgaggcg
aatatcaagaagcaggaggagcacagcgacaccgatcccggcaccgtgatcaatcaatcg
ccggcggccggcgagcagttcgatccgaagaagacgaacgtcacgctgacggtcagcaaa
gggccggctacgttcaagatgcccgatctgaggggcaaaaacgaggagcaggcgcgcagc
cagctgcaggcgctcggcctgcggctgaccggagacgaggtcgtatacgaaccgagcttc
accgtcccgaaaggcgaggtgatggagcagtatccgtacgctccgggcgccgaagtgacg
aaaaacgccgaagtgacgcttacggtcagctccggaccgccgaaggacgcgatcgagtac
acgtacaacgtcgtcatcagtcccgccgaagtgggagggacgagcgaggttcacatcgtc
tactccgacgcgcggggcgaaaatatcgactggggaacgaaaaaaatcaacaatacgaag
acgttccaggtcaagctcgtgctcgttccgaatacggaagcgaccgtgacgatcgaacgc
gacggcgtctttatggattcgtcctcgatcacgtacgacgaggcggtttcgggcgagcat
ccgggcaccgtatttattcccggattcgaaatgtcaaacggcttcttccaggacgagacg
ccgcctgacggcgagcagccggagaacggagaaacggacgacggcgagcgcggcagagac
gaagaccggggcagaggcaagcgggataatcgcgacggggagaacggcgagccatga

DBGET integrated database retrieval system