KEGG   Paenibacillus sp. 32O-W: IJ21_32200Help
Entry
IJ21_32200        CDS       T04219                                 

Definition
(GenBank) xylulose 5-phosphate 3-epimerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
pow  Paenibacillus sp. 32O-W
Pathway
pow00040  Pentose and glucuronate interconversions
pow00053  Ascorbate and aldarate metabolism
pow01100  Metabolic pathways
pow01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pow00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    IJ21_32200
   00053 Ascorbate and aldarate metabolism
    IJ21_32200
Enzymes [BR:pow01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     IJ21_32200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ALS28611
UniProt: A0A0U2W037
LinkDB All DBs
Position
3555221..3556054
Genome map
AA seq 277 aa AA seqDB search
MLKSVNQWCFPEGTSLDRLFDVSREAGYDAVELNVNPPGSAGLTMETTPAEADAIARQAA
ARGLKLRSVSTSLLWRHPLSSEDADVRAQGRRIVVKQLELAERLGADTVLVVPGAVTPTA
PYDECYDRSLEELKKLVPEAEKRGVRIGIENVWNKFLLSPLEMRSFVDELASPYAGVYFD
VGNILAYGFPQQWIRILGRRIFKIHVKDFKTAVGNGGGFVPLLAGDVNWPEVAAALRDIG
YDDTLTAEIGVYGADPLQAVYDTARQLDVIIRGVRTV
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaagcgtcaatcagtggtgctttcccgaaggaacgtcccttgacaggctgttc
gacgttagccgcgaggcaggctacgacgccgtagagctcaatgtcaacccgcccggctca
gccggacttacgatggagacgacgccggcggaggcggacgcgatcgcgcggcaggcggcg
gcacgcgggctgaagcttcgcagcgtctccacatcgctgctgtggagacatccgttgtcg
tccgaagatgccgatgtccgggcgcaaggccgccgcatcgtcgtcaagcagctcgagctg
gccgagcggctcggggccgacaccgtgctcgtggtgcccggcgccgtcacgccgacggct
ccttatgacgaatgctacgaccgcagcctggaggagctgaagaagctcgtgcccgaagcg
gagaaacgcggcgtcaggatcggcatcgagaacgtgtggaacaagtttctgctttccccg
ctggagatgcggagcttcgtcgacgagcttgcttcgccgtatgccggcgtctatttcgat
gtcggcaacatcctggcgtacggcttcccgcagcaatggatccgcattctcggccgccgc
atctttaaaattcacgttaaagacttcaaaaccgccgtcggcaacggcggcggcttcgtc
ccgctgctggccggcgacgtcaactggccggaagtcgcggccgcgcttcgggatatcggg
tacgacgatacgctcaccgcggagatcggcgtctacggcgccgatccgctgcaggccgta
tacgacacggcgcgccagctcgacgtcatcattcgcggcgtccggacggtataa

DBGET integrated database retrieval system