KEGG   Paenibacillus sp. 32O-W: IJ21_43250Help
Entry
IJ21_43250        CDS       T04219                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pow  Paenibacillus sp. 32O-W
Pathway
pow03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pow00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    IJ21_43250
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pow03400]
    IJ21_43250
Enzymes [BR:pow01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     IJ21_43250
DNA repair and recombination proteins [BR:pow03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     IJ21_43250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ALS29688
UniProt: A0A0U2UUW7
LinkDB All DBs
Position
4774666..4775655
Genome map
AA seq 329 aa AA seqDB search
MSNESHLWKPVVPFEPVATDSYPNGGEWIAQVKWDGVRVLVYADRGQVRLFNRRLNERTM
QYPELAQTSDYCRSDTFVLDGEMIALEGGKPSFHQVMRRDGVRKAVSAAAARREVPVVYM
VFDVLYADGEWVTARPLRERQALLERLVKPGPHVQAVRSETSLRGLYEAVDKLELEGVVF
KDLNSAYEIGGKDKRWRKKKRFRDLVAVVGGVTYRDNLVNALLLGLYDAEGRLWYIGHAG
AGAFTQNDWRHMTREAARLRTADRPFANMPVRSRDAVWLRPLLTVKTNYMSWTPDMALRQ
PVLQSLTDLPPEACTFQSQAPDLIRKEEP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgaatcccatctatggaagccggttgtcccgttcgagccggttgcgacggac
agttatccgaacggcggggaatggatcgcgcaagtaaaatgggacggagtccgggtgctg
gtctacgccgaccggggacaggtccgcctgttcaaccggcggctgaacgaacggacgatg
caatacccggagctggcgcagacatccgattactgccggtccgatacgttcgttctggac
ggcgaaatgatcgcgctcgagggcggcaagccttcgttccaccaggtgatgcggcgggac
ggcgtacggaaggcagtcagcgcggcggccgcccgccgggaggtgccggtcgtctatatg
gtgttcgatgtgctgtatgccgacggggagtgggtaacggcgcgcccgctgcgcgagcgc
caggcgctgctggagcggctcgtcaaaccggggccgcacgtgcaggcggtccgcagcgag
acgtcgctgcgcggactgtacgaggcggtcgacaaactcgaattggaaggcgtcgtgttc
aaggacttgaacagcgcatacgaaatcgggggcaaagacaagaggtggcgcaagaagaag
cgattccgcgatcttgtcgccgtcgtcggcggcgtcacgtaccgggacaacctggtcaac
gcgctgttgcttggcctgtacgatgcggaagggcgtctctggtacatcggccatgccgga
gccggcgccttcacgcagaacgattggcggcatatgacccgggaagctgccagactccgg
acggcggaccggccgttcgccaacatgcccgttcgaagccgcgacgccgtctggctgcgg
ccgcttctgaccgtcaaaacaaattatatgagctggacgccggatatggcgctgcgccag
ccggtgctgcaaagcttgaccgatctgccgccggaagcgtgcacgtttcagtcccaggcg
cccgatctgatccggaaggaggaaccgtaa

DBGET integrated database retrieval system