KEGG   Paenibacillus sp. 32O-W: IJ21_48340Help
Entry
IJ21_48340        CDS       T04219                                 

Definition
(GenBank) 2,3-diketo-5-methylthiopentyl-1-phosphate enolase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pow  Paenibacillus sp. 32O-W
Pathway
pow00630  Glyoxylate and dicarboxylate metabolism
pow01100  Metabolic pathways
pow01120  Microbial metabolism in diverse environments
pow01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pow00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    IJ21_48340
Enzymes [BR:pow01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     IJ21_48340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ALS30195
UniProt: A0A0U2W4Q9
LinkDB All DBs
Position
complement(5362501..5363763)
Genome map
AA seq 420 aa AA seqDB search
MHNERVIATYLIETPYPLEKAAEAMAGEQSTGTFIAVPGETPELKAQHGAQIVGLEQIGE
YDRPSLPECYVPPGIDKPVYRRAIVKLSFPLHNFGPSLPNLLATVAGNLYELREFSGLRL
TDLELPEAFAARYPGPKFGIEGTRRLAGVHDRPIIGTIVKPSIGLPISEYGPLIRELAEA
GLDFVKDDELCGDPPAAPFEQRVAAVMAEIERAADRTGKKMMYAFNISGDIDEMRRRHDI
VAKAGGTCVMVSINSVGWAGVAHLRQYAELPIHGHRNQWGAMTRYPLLGMSFTAYQKLCR
LAGVDHLHTNGLNSKFAESNESVAQSIRDCLTPMFGGYTVMPVLSSAQWAGSAIPTYRAV
PTQDVIHLAGGGILAHPGGIAAGVRSMRQGWEAAVQGIELDEYARSRPELQAAIRTFGKK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
ttgcataatgaacgagtcattgccacatatctaatcgagacgccttacccgctggagaaa
gcggcggaagcgatggccggcgagcaatcgacgggaacgtttattgccgtgcccggcgag
acgccggaattgaaagcgcaacacggcgcgcagatcgtcggcctggaacagatcggcgaa
tacgaccgtccttcgcttccggaatgttacgtgccgccggggatcgacaagccggtctat
cggagagcgatcgtgaaactgtcctttccgctgcacaacttcggtccttcgctgccgaac
ctgcttgcgaccgtagcgggcaacttgtatgagcttcgggaattttccggactccggctg
acggatctggagctgccggaagcgttcgcggcgcgttacccggggccgaaattcggcatc
gaaggaacgcggcggctggccggcgtgcatgaccgcccgatcatcgggacgatcgtgaag
ccgagcatcggcttgccgatatccgagtacggcccgcttattcgggagctggcggaagcg
gggctcgattttgtcaaggatgacgagctgtgcggggatccgccggccgcgccgttcgag
cagcgggtcgccgcggtgatggctgaaatcgagcgggccgccgaccggacgggcaagaag
atgatgtacgcgttcaacattagcggcgatatcgacgagatgcggcgccggcacgatatc
gtagcgaaggcgggcggcacttgcgtcatggtcagcatcaacagcgtcggatgggcgggc
gttgcccatctgcgccagtatgccgagctgccgattcacggccaccgcaatcaatggggc
gccatgacccgctatccgctgctcgggatgagctttaccgcgtaccagaaattgtgccgg
cttgccggcgtcgaccatctgcatacgaacgggctgaacagcaaattcgccgagagcaac
gagtcggtcgcgcagtcgatccgggattgtctgacgccgatgttcggcggctacacggtg
atgcccgtattgtcttccgcgcaatgggccggcagcgcgattccgacgtaccgggcggtg
ccgacgcaagacgtcattcatttggcgggcgggggcattctggcccatcccggagggatt
gccgcaggcgtccgcagcatgcgccagggctgggaggcggccgtgcaaggcatcgaactg
gacgagtatgcgcgctcccgcccggaattgcaggcggcgatccgcacgttcgggaagaag
tag

DBGET integrated database retrieval system