KEGG   Pandoraea oxalativorans: MB84_09930Help
Entry
MB84_09930        CDS       T03840                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pox  Pandoraea oxalativorans
Brite
KEGG Orthology (KO) [BR:pox00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MB84_09930
Enzymes [BR:pox01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MB84_09930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO FAD_oxidored HI0933_like Glutaredoxin Thi4 FAD_binding_3 NAD_binding_8 K_oxygenase FMO-like Thioredoxin_4 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AKC69732
UniProt: A0A0E3YCF7
LinkDB All DBs
Position
1153169..1154761
Genome map
AA seq 530 aa AA seqDB search
MLDANLKAQLQTYLQKVTRPIEIAVWLDDSPKSAEMKALIEEIAPLSDKIAVVARTDAGE
RRPSFAIGTPGEAPRIRFAGLPMGHEFTSLVLALLQVGGHPLKLDDDTIEQVRALDGDFR
FETYISLSCQNCPEVVQALNVMALINPRIQQVTIDGALFQNEVEARQVMAVPTVFLNGES
FTQGRTSVKELLAKLDTGATARAAKALENKPVYDMLIVGGGPAGAAAAIYAARKGITTGV
VAERFGGQVLDTMAIENFVSVTHTEGPKFATALEQHVKTYDVDVIDTQRAEALIPGKIHE
VHLASGAVLRARAVVLATGARWREIGAPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKEVTLIEYGTQLRADEVLQRKLRSLANVRVLMNAQTTEIVGDGQKV
NGLTYLNRATGERSTIALEGVFVQIGLVPNTEWLKGTVSLSRHGEIEVDAKGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFEHLMLSSVEDDVDAEQNEAAVA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcgaacctcaaagcccagttgcaaacgtatctccagaaagtcacgcgcccc
atcgaaatcgccgtgtggctcgacgacagccccaagtccgcagaaatgaaggcgctgatc
gaagagatcgcgccactctcggacaagatcgccgttgtggcacgcaccgatgccggcgag
cgtcgtccgtcgttcgcgatcggcacgccgggggaagcaccgcgtattcgctttgccggg
ttgccgatgggtcacgagttcacgtcgctggtgttggcactgctgcaagtcggcggtcac
ccgctcaagctcgacgacgacaccatcgaacaggttcgcgcgctcgacggcgacttccgc
ttcgagacgtatatttccctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatggcgctcatcaacccgcgtatccagcaagtcaccattgacggcgcgctctttcag
aacgaagtcgaagcgcgtcaggtgatggccgtgccgacggtgttcctcaacggcgaatcg
ttcacgcaaggccgcaccagcgtgaaggaactgctggcgaagctcgacacgggggcgacg
gcgcgtgcagcgaaggcgctggaaaacaagccggtctacgacatgctgatcgtcggtggt
ggccccgcaggtgcagcggccgcgatttacgctgctcgcaaggggattacgacgggcgtc
gtcgctgagcgtttcggcgggcaggtgctcgacacgatggctatcgagaacttcgtctcc
gttacgcacaccgaagggccgaaattcgccacggcgctcgaacagcatgtgaagacctac
gacgtcgacgtgatcgacacgcaacgcgccgaagcgctgatcccgggcaagattcacgaa
gtgcatctggctagcggtgcggtgctcagagcccgcgccgtggtgctggccaccggtgca
cgctggcgcgaaatcggcgcgccgggcgagcgcgaatatcgcaatcgcggcgtagcctac
tgcccgcactgtgacggcccgctcttcaagggcaagcgcgttgcagtggttggcggcggc
aattcgggcgtagaagcggccatcgatctggcgggcatcgtcaaggaagtcacgctgatc
gaatacggtacccaactgcgcgccgacgaggtgctccagcgcaagctgcgcagcctggcg
aatgtgcgtgtgttgatgaatgcacaaacgacggagatcgtcggtgacggccagaaggtg
aacggcctgacctacctgaaccgtgccacgggcgagcgctcgacgattgcgctcgaaggt
gtgttcgtccagatcggtctggtgccgaacaccgaatggcttaagggcacggtgtcgctc
tcgcgtcatggcgagatcgaagtcgatgccaagggcgcaacctcggtgccgggcgtgttc
gccgcaggcgacgtgacgactgtgccgttcaagcagatcgtgatcgccgtcggcgaaggc
gcgaaggcgtcgctcggtgcgttcgaacacctgatgctcagctcggtagaagacgacgtc
gacgccgagcagaacgaagccgccgtggcctga

DBGET integrated database retrieval system