KEGG   Komagataella phaffii: PAS_chr1-4_0433Help
Entry
PAS_chr1-4_0433   CDS       T01092                                 

Definition
(RefSeq) Peroxisomal signal receptor for the N-terminal nonapeptide signal of peroxisomal matrix proteins
  KO
K13341  peroxin-7
Organism
ppa  Komagataella phaffii
Pathway
ppa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ppa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PAS_chr1-4_0433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 8197021
NCBI-ProteinID: XP_002490564
UniProt: C4QYG0
LinkDB All DBs
Position
1:2202478..2203608
Genome map
AA seq 376 aa AA seqDB search
MFKFQTNGFSGYAVRYSPFYDNKIAVATSANYGLVGNGRLYVLSIMDDGNIITDISYDTQ
DGLFGVAWSETNENHVLTSSGDGCVSLFDTTLKDYPVMKFTEHQREVFSVDWSNIDKNLF
CSASWDGSVKVWSPGSNRNTSLLTLRSLASREEKTGRIEKPIPVVQPSQVPMSKTRPNIR
NDNNDCVYDAKFSFHDPNIIMSCNSDSHLQLWDTRLPNPLFMDFVAHNGLEALSCDFNRY
RPFVVASAGVDKLAKVWDTRMIQPNVHSRPPRALNKFMGHEFAIRKLAWSPHGPTQLLTC
SYDMTVRVWNDSPSPTSRVGLLDGASQPHAPPCSKIFSAHTEFVMGCDWSLWGEPGWVVT
TGWDEMVYVWNTQRLQ
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagttccaaacaaacggttttagtgggtatgccgtaagatattcgccgttttat
gataacaagatagctgtggccacttccgccaattatgggctcgtcggtaatgggcgttta
tacgtgctatccataatggatgacggcaatataataaccgacatatcttatgacacacag
gatggtctcttcggtgtcgcttggtctgagactaatgaaaaccatgttttgactagctct
ggagatggctgcgttagcctatttgacacaacactaaaggattatccagtaatgaaattt
acagagcatcagcgggaagtattctccgtcgattggagtaatatagataaaaatctgttt
tgttcagcatcatgggatggttcagtaaaagtatggagtcccggatccaatagaaataca
tccctgttaacgttaagatcattagcaagtagggaagaaaaaaccggaagaatagaaaaa
ccaataccagtggttcaaccttctcaagtccctatgtcaaaaacacgtcctaatataagg
aatgacaataatgactgcgtttacgatgctaagttctcctttcatgatcccaatatcata
atgtcatgtaattcagattctcacttgcagctttgggatacgaggctacctaatcccctt
ttcatggactttgttgcacacaacggcctagaagctctttcgtgcgactttaatcgttat
cgaccttttgtagttgctagtgccggtgttgacaagctcgcaaaggtctgggatacccgc
atgatacaaccaaatgttcattcaaggcctcccagagctctaaataagttcatgggccac
gagtttgcgataagaaaactagcctggtctcctcatggccctactcaacttttgacatgt
tcgtatgatatgacggttcgtgtttggaatgacagtccttctcctacttctcgtgttggc
ctgctggacggagccagtcaacctcatgcaccaccgtgttccaagatattctctgcacat
acagaattcgtaatgggttgtgattggagtttatggggtgaaccaggctgggttgtcaca
acaggctgggatgaaatggtatacgtttggaatacacagagacttcagtaa

DBGET integrated database retrieval system