KEGG   Komagataella phaffii: PAS_chr2-1_0089Help
Entry
PAS_chr2-1_0089   CDS       T01092                                 

Definition
(RefSeq) Component of the mitochondrial alpha-ketoglutarate dehydrogenase complex, which catalyzes a key step
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ppa  Komagataella phaffii
Pathway
ppa00020  Citrate cycle (TCA cycle)
ppa00310  Lysine degradation
ppa00380  Tryptophan metabolism
ppa01100  Metabolic pathways
ppa01110  Biosynthesis of secondary metabolites
ppa01130  Biosynthesis of antibiotics
ppa01200  Carbon metabolism
Module
ppa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAS_chr2-1_0089
  09105 Amino acid metabolism
   00310 Lysine degradation
    PAS_chr2-1_0089
   00380 Tryptophan metabolism
    PAS_chr2-1_0089
Enzymes [BR:ppa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     PAS_chr2-1_0089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 8198485
NCBI-ProteinID: XP_002490970
UniProt: C4QZL6
LinkDB All DBs
Position
2:complement(156825..159830)
Genome map
AA seq 1001 aa AA seqDB search
MLKSFKGISSRSSILRNAPRRLIQTRLLATDSFLQSNNANYIDEMYEQWSKDPSSVHSSW
NAYFKNLDQGVPPSRAFQAPPTLIPQPAGGIPNLVPVGNASGNSNVLTHLKAQLLVRAYQ
VRGHQKAKIDPLGISFGDDKSKPVPKELTQEFYGFTEADLDTEITLGPGILPKFAEAGHP
TMKLRDIIKACEKIYCSSYGVEYVHIPSREKCDWLRERIEIPTPYKYSVDEKRQILDRLI
WSCSFENFLSSKFPNDKRFGVEGAESVIPGMKALIDTAVENGVEDVVIGMAHRGRLNMLS
NVVRKPNESIFSEFTGSKDFDEGSGDVKYHLGMNYVRPTTSGKKVHLSLVANPSHLEAED
PVVLGRTRAIQHYKGDVGEFNKAMGILVHGDAAFAGQGIVYETMGFAALPAYSTGGTIHI
IINNQIGFTTDPRFARSTPYPSDIAKSINAPILHVNADDVESVIFNFQLAAEWRQTFHSD
VILDVVGYRKYGHNETDQPSFTQPLMYQKIAEKKQVLDIYVDKLIKEGSFTLDDINEHKQ
WVWNTLEEAFTKSVEYKPTSREWLTTPWEGFKSPKELASEVLPHLPTSVERGVVERIGDT
ISSWPEGFEVHRNLKRILKNRKDSIQKGEGIDWSTGEALAFGSLVIEGYHVRISGQDVER
GTFSQRHAVLHDQNSEKVYIPLKHLSKVQSDFGISNSSLSEYGCMGFEYGYSLTSPDALV
MWEAQFGDFANTAQVIIDQFLAAGESKWKQRSGVVLSLPHGYDGQGSEHSSARLERYLQL
CNEDPRVYPSPEKLERQHQDCNMQVAYPTTPANLFHLLRRQMHRQFRKPLILLFSKKLLR
HPLARSNIEDFIGESSFQWIIEDSELGKTINDKEGIKRLVLCSGQVHSSLHKKRADIGDK
ETAVLKIEQLHPFPFEQLKNAIDSYPSLDEIVWCQEEPLNMGSYAFSAPRIVTVLEQTEK
YKDYNLRYAGRNPAAAVAVGTKSMHVAQEEAFLDDVFQIQN
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaatcattcaaaggcatctcctccaggagcagcatcttgaggaatgctcccaga
cgattgatccagaccagattattggccaccgattcatttttgcagtcaaataacgccaac
tacattgatgaaatgtacgaacaatggtccaaggacccgtcatctgttcactcgtcgtgg
aacgcttatttcaagaacttagaccagggcgtccccccatctcgtgccttccaagcacca
ccaaccttgattccacagccagctggtggtattcccaacttggtgcctgtaggtaacgca
agtggcaactccaatgttttgacgcatttgaaagctcagctgttggttcgtgcttatcag
gtcagaggtcaccaaaaggctaaaattgaccccttgggaatctcctttggtgacgacaag
tccaaaccagtgccaaaggaactgactcaggaattttatggttttaccgaggcagacttg
gacactgagattactctcggaccaggtattcttcctaagttcgccgaggctggacacccc
acaatgaaactacgtgatattattaaggcatgtgagaaaatctactgttcatcctacggt
gttgagtatgttcatatcccttcaagagagaagtgtgactggctcagagagagaattgaa
attccaaccccttacaagtactccgtcgatgagaagagacaaattcttgacagacttatc
tggtcttgttcttttgaaaactttctgagttccaaattccccaacgacaagagatttggt
gttgaaggtgccgagtctgtcattccaggtatgaaggctctgatcgacactgccgttgaa
aacggtgttgaggatgtagtcattggtatggcccaccgtggtcgtctgaacatgttgtca
aacgttgtcagaaaacccaatgagtctatcttctccgagttcactggttctaaagatttc
gatgaaggatctggtgacgtgaaataccatttgggtatgaattacgttcgtccaactaca
tccggtaagaaagtccacctttccttggttgccaatccttctcatttggaggcagaagat
cccgttgttttgggtagaactagagctatccagcactacaagggagatgttggtgaattc
aacaaggctatgggtattttggtccacggtgatgctgcttttgccggtcagggtatcgtt
tacgaaactatgggtttcgctgccttaccagcttattctactggtggtaccatccatatc
attattaacaaccaaattggtttcacaacggatccacgttttgctagatccactccttac
ccatctgatattgccaaatcaatcaatgctccaattttgcatgttaatgctgacgacgtt
gagtcagttattttcaacttccaattggcagctgaatggagacagactttccactccgat
gttattttggatgttgttggctaccgtaaatacggtcacaacgaaactgaccagccttct
ttcacccagcctttgatgtaccagaagattgctgagaagaagcaagtgctcgatatttac
gttgacaagttaatcaaggagggatcattcactctagatgacatcaatgaacacaagcaa
tgggtttggaacacattagaagaagcatttaccaagtctgttgagtacaaacccacctcc
agagaatggttaacaacaccttgggagggattcaagtctccaaaagaattggcttctgaa
gtattgcctcacttgccaacctctgtggaaaggggcgtagttgagagaatcggtgacacc
atctcttcttggcctgaaggatttgaggttcacagaaatttgaagcgtatcttaaagaat
agaaaagattccattcaaaaaggtgagggtattgactggtctactggtgaagctcttgcc
tttggaagtttggttattgaaggttatcatgtcagaatttccggccaagatgttgaaaga
ggaaccttctcccaacgtcacgccgttcttcacgaccaaaactccgaaaaagtctacatt
cctctcaaacatctaagtaaagttcaatccgacttcggtatttctaactcttccctttca
gaatacggatgtatgggttttgagtatggttactcactgacctcacctgatgctttggtt
atgtgggaagctcaatttggtgacttcgctaacactgctcaagttattattgatcaattc
cttgccgctggtgaatctaaatggaagcagagatccggtgttgtcctttctttgccccat
ggttacgatggtcaaggttccgagcactcttctgcccgtttagaacgttacttgcagctt
tgtaatgaagacccaagagtttatccatctcctgagaagctggagagacaacatcaagat
tgtaacatgcaagttgcttatccaaccactccagccaatctgttccatctgttgagacgt
caaatgcaccgtcaattcagaaagcctttaattttgctcttttcgaagaagttgttgcgt
cacccattggccagatctaacattgaagatttcattggagaatctagtttccaatggata
attgaggattctgagctgggcaaaaccatcaatgacaaggagggtattaagcgattagtt
ctttgttctggtcaagttcattcttctttgcacaagaagcgtgctgatattggcgacaaa
gagaccgctgtattgaagattgaacaactgcacccattcccattcgaacaattgaagaac
gccattgatagctacccatctttggatgagattgtttggtgtcaggaagaaccattgaac
atgggttcttacgcattttctgcaccaaggatagtaaccgtattggaacagaccgagaag
tacaaggattacaacctgcgctatgctggtagaaacccagcagctgctgttgccgttggt
actaagtcgatgcacgttgctcaagaagaggctttcttggacgatgtcttccaaatccaa
aattaa

DBGET integrated database retrieval system