KEGG   Komagataella phaffii: PAS_chr2-1_0179Help
Entry
PAS_chr2-1_0179   CDS       T01092                                 

Definition
(RefSeq) S-adenosylmethionine-dependent methyltransferase of the seven beta-strand family
  KO
K19589  release factor glutamine methyltransferase [EC:2.1.1.297]
Organism
ppa  Komagataella phaffii
Brite
KEGG Orthology (KO) [BR:ppa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ppa03012]
    PAS_chr2-1_0179
Enzymes [BR:ppa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.297  peptide chain release factor N5-glutamine methyltransferase
     PAS_chr2-1_0179
Translation factors [BR:ppa03012]
 Eukaryotic Type
  Release factors
   PAS_chr2-1_0179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_25 Methyltransf_31 Methyltransf_12 UPF0020 Methyltransf_4 Methyltransf_16 PrmA
Motif
Other DBs
NCBI-GeneID: 8198092
NCBI-ProteinID: XP_002491068
UniProt: C4QZW4
LinkDB All DBs
Position
2:338334..339011
Genome map
AA seq 225 aa AA seqDB search
MLPTPLTKDLDFEKVYEPAEDSFLLLDVFEKEKPWLESYKWNSDVPLVVEIGTGSGVVTT
FVNQHIIPQGLFLATDLNPHCCNAVLGTHKRNIGKKGNLQVLQCDLTTPLRRNQVDVLIF
NPPYVPSETVPEVARDPDSEDWLDIALLGGPTGMDITEKVLDSLYDTLSRNGVAYILFCA
RNHPERVMENFKAKETQRGNGWEIECVQHRKAGWEVLTVWRFIRR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgctaccaacacctttgaccaaagatctagactttgaaaaggtgtatgagccagcagaa
gactcctttctacttttggacgtctttgagaaagaaaagccgtggttggaaagctacaag
tggaactcagatgtccctctcgtggtggaaataggaactggatcgggagttgtaaccaca
tttgttaatcaacacataatccctcaaggactgtttcttgccactgacttgaaccctcat
tgctgtaatgctgttttaggcactcataaaaggaatattggaaagaaaggtaatttacag
gtgcttcaatgtgatttgacaacgcctttaaggagaaaccaagttgatgtcttgattttc
aacccaccctatgttccttcggagacagtaccagaggtagcacgggatccagattccgaa
gattggttggatattgcactgttaggaggacctacaggtatggatattaccgaaaaggta
ttggattccttatatgataccctcagtcgaaatggagtggcatacatactcttttgtgcg
agaaaccaccccgaaagagttatggaaaattttaaagccaaggagactcagagaggaaat
ggatgggagattgaatgcgtacaacatcgtaaagctggatgggaagtgttgactgtttgg
aggtttattcgaaggtag

DBGET integrated database retrieval system