KEGG   Komagataella phaffii: PAS_chr2-1_0180Help
Entry
PAS_chr2-1_0180   CDS       T01092                                 

Definition
(RefSeq) Protein of unknown function, essential for viability
Organism
ppa  Komagataella phaffii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dopey_N
Motif
Other DBs
NCBI-GeneID: 8198563
NCBI-ProteinID: XP_002491069
UniProt: C4QZW5
LinkDB All DBs
Position
2:complement(join(338998..340789,340887..343352,343412..344025))
Genome map
AA seq 1623 aa AA seqDB search
MSPLGKGDVSARDKKYLSNVQKTIASFASVVEWADYISFLGRLQKALQSNPSKDTHWIPE
AYQVSKLLSQCLSNTLPNGVHKKCLELYHDIFIMLGQEKLGQDISIWLPGLLPLMNYASI
TVRPQLIDLFSSFVAKIAPAYLHPVLRALLLGIWPALDDPTSECFESAFQLVDNLKKAVD
DNEHFWKCLFLSIINSGDRKLGALFQNENILALLSSEARECVNPEPGLLITAMCKGLQDE
SIFVQRGFFDLLTSRLELRSDVIQKLASQSDKEKLLLTATSTVLKKDMSLNRRLWFWLLG
PETSESSPTSRSEYFKNYGLEILTSSLLKLLDGNFTGESIHAQKLQSFKISLAVLDKWEI
AQFVIPRIFLPSLEACKETATPEILMGFGSLFDSVEAVDIWSDFIKLIETKNYELMKFML
KNFNIDDEDMIVRHVPLVLITILISAGSAVDSEYGSWIEIARIISNIIPARAYLPLEHAD
AEDQSVENIKENIDKFYSEKTDSLPYNPATVADITYNLLKTLVSKQLNSSAGHLAFTSDL
LADFVERLPTTEESPKLVNDQLIQQIVDLPFNNDLNIDLSFGLIKLVPYLSSIATHFQLL
QLLKKIIGSLWPIICDPRGIFQVEVVNSITKLEIFVDPHCIEGELAYLFLSSEFPFPDKL
RAVATLWTHTNTISGSSTDSILSRSLELVVDNLAEKRSPRYVMVSKWIDNLLRSSSINRL
YKNLVNPILTSNRFLSTGEITDEDDLALFAYQIETIINLLTLESSSIQDSFANELCVLDS
DEEIHIVNTNNWNVDTYKMLLVNILKQFISIPKVASDIQDYERCTISVVSLLELLIDGEE
KVFSEIVEYLLEAIPSSPVIYLECLTKLLSLAHSKHIGISIFEVRDDSCLFIDFLKQRIA
TSRDIVEIECLMQLVSQCSLFLNDSIFSIVVPLTSTICRRLSDDFESYKSYVTGDIYSVD
SKQLTPDLEQIIPLLMNGLEDLLTSTHGYWKATEASESVDLSKNANDQGFFGSMINGVFQ
AGGNKDLSVSISDNSNEASSITDLGLTISYAASTLKYRPKKLLGTLYGLESIETLESLVS
FRITNSSIFKLIHILDGAKHDLALQFLLNSLTSRVFPNSLDEDQVSTLNIELTEHEIVTF
ILGYCQSLDNDSIEDIWLTFTQFLKDVESNNVLYRQTLPGLIKITHSIGVKNTHTRFGEQ
KKIKRELSDHFVKLLNFSINARLDHFEDIGDDSGKVLRSSELCEAMKDVSPKLTQLITDR
DKLSGIVSSLISNVLQPIVKSKSIPNIPDLVLELILAWTENGCLEFKSWKGFLGDVLNDT
DFFKVQPSQREYWDRIFVKYIGAESEKMAELVTKFQSLNNSNNLFNWNDAEIRGRSLLVK
RICYLILIGPQDTFMDSLKEIMFRLNEIIKDSTMKPLLFLTLRILVLKFSPIHLSPYWTL
IVSQMEELLLDVLEKSTLLDGAVEKDHNHGNGKHKLRKEAARPELEIDLDSLLSGCKLLD
VLIMMKPEEFQLSEWLFIQDSALSQSDDKTDTAIPALIERLSHIKDLNRYSVLKSLNYEL
TEKTRRKPLLEGINTIDNIGELKEFFDSLSFHDFECNYNINAPDYDAPIADSFADVFEAS
TFE
NT seq 4872 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctttaggaaagggagatgtgtcggcaagggataaaaagtacttgagtaatgtg
caaaaaactattgctagttttgcctctgtggttgaatgggctgattacatctctttccta
ggacgactacagaaggctcttcagagcaacccttccaaggatacccattggatccctgaa
gcttaccaagtttccaagctattgagccaatgcttgtcaaatactctaccaaatggagta
cacaaaaagtgtttggagctttatcacgacatttttatcatgcttggccaggagaaactg
ggacaagacatttccatatggcttccgggcctgctgccattaatgaactatgccagtatc
acagtgagaccccaattgatcgatttgttctcctcttttgtggcaaaaatagcgccagct
tatcttcatcccgttttaagggctttgttactgggaatctggcccgctctggatgatccc
acctctgaatgtttcgaatctgctttccagctggtggacaatctgaaaaaagcagtagat
gataacgaacacttctggaagtgtctattcttgtccattattaactctggtgatagaaaa
cttggtgccttattccagaacgagaacatattagctcttttgtctagtgaagcaagagaa
tgtgtgaatccagagcccggtttgcttattactgccatgtgtaagggtcttcaagacgag
agtattttcgttcaacgaggattttttgatttgttgacatcccgtctggaattgcgatca
gatgtcattcagaaactggcttcacaatcagataaggaaaaattgctgttaaccgctact
tctaccgttttgaaaaaggatatgtcgttgaatagacgactttggttttggttattgggc
ccggaaacatctgaatcgtctccaacttcacgctcagaatactttaaaaattatggtttg
gagatattgacatccagccttttgaaacttctagatggaaactttacaggtgaatctatt
catgcccaaaagttacaaagtttcaaaatatcacttgcggtgctggacaaatgggaaatt
gcgcagtttgtaataccaagaatattccttccttcactggaagcctgcaaggaaaccgca
acacctgaaattttaatgggatttggatcattatttgatagtgtcgaagcagttgacatc
tggtcagattttataaaattgattgagactaagaattatgagcttatgaaattcatgctg
aaaaatttcaacattgatgatgaagacatgattgtacggcatgttcctttggtattgatc
acaatcttaatatcagcaggctcagcagttgactctgaatatggttcttggatcgagatt
gcacgcatcatttcaaatatcatacccgctcgagcttacctcccattagaacatgcagac
gcagaggaccaatcagttgagaacattaaagaaaatatagataagttctactctgagaag
acagattccttaccgtataatcctgcaacggtagcagatatcacctacaatctattaaag
acattggtttcaaaacagttgaactcttcagcaggtcatcttgcctttacgagtgatctt
ctagcggatttcgtagagagactgccaaccacagaagagtcccccaaattggtcaacgat
cagctgatacaacagatcgttgatttgcccttcaacaatgatttaaacattgacttatca
tttggtctcatcaaattggtaccatatctctcatcaattgctactcattttcaactactg
caacttttgaaaaaaatcatcggttcattgtggccaataatttgtgatccaagaggtatt
ttccaggttgaagttgtcaattcgattacaaagctagaaattttcgttgaccctcattgt
atcgaaggagagttggcatatctttttcttagctccgaattcccgttccctgataaactt
cgtgcagttgctactttatggactcacaccaacaccattagtggatctagtactgatagc
atcctatcaagaagtttggagttagtggtagacaacttagccgagaaaaggagcccccgt
tacgttatggtttcaaaatggatagacaacctgttgcgatctagtagtattaacaggctg
tataaaaaccttgtcaatccaatactcaccagcaatcgttttttatcaactggtgaaata
acagacgaggacgatttagcattgtttgcctatcagattgaaacgataattaacctatta
actctggagtcaagcagtattcaagattcgttcgcaaacgagctatgtgtcttggattcg
gatgaagagattcacattgtaaacacaaacaattggaacgtcgacacttataaaatgctt
cttgtgaatatattaaaacagttcatatcaataccaaaggttgcaagcgacattcaagac
tatgaacggtgcacgatatcggtagtttcactgctagaacttcttattgatggagaagag
aaagtgttttcagagattgttgagtatttattggaagctatcccaagctcacccgtaatt
tacttggaatgtttgacaaagctgttatctctagcccattcaaagcatatcgggatttca
atttttgaggtaagggatgatagttgccttttcatagatttcctcaaacaaagaatagca
acatcccgagatattgtggagatagaatgcttaatgcagctagtctctcaatgttctctc
tttctaaacgacagcatattttcgattgtggttcctcttacatccacaatttgccgtagg
ttgtcagatgattttgaaagctacaaaagttatgttactggagatatttacagcgttgac
agtaaacagttgactcctgatttagaacagatcatcccgttacttatgaatggtttagaa
gatcttctaacatctacgcatggttattggaaagctactgaagcatcagagtctgttgat
ctaagcaagaacgcgaatgatcaaggtttctttggttcaatgatcaatggtgtattccag
gcaggcgggaataaggatctctcagtttccatctcggataactcaaatgaagccagctcc
attacagatctgggtctgactatcagttatgctgcctcaactctgaagtatcgtccaaaa
aaactattgggaacactttacggtttggaaagtattgagactttagaatcccttgtctca
tttaggatcaccaatagttctattttcaaattgattcatattttggatggtgccaaacat
gacttggctttacagttccttttgaactcgttgacatcacgggtatttccaaattcatta
gatgaagatcaagtttcaacattaaatattgaacttacagaacatgaaatagtgacattt
atactgggatactgtcaatcattagacaacgatagcattgaagacatttggcttacattt
acccagtttttaaaagacgtggagtctaacaatgtactttataggcaaaccctgcctggt
cttataaagatcactcattccatcggtgtaaagaacacacataccagatttggagagcaa
aagaagatcaagagagaattaagtgatcactttgtaaaattattgaatttctctattaat
gcaagattagatcattttgaagatataggtgatgactcgggcaaagttttgaggtccagc
gagttatgtgaagctatgaaagacgtttcgcctaaactaacccaattgatcaccgacaga
gataagctttccgggattgtatcatccttgatttcaaatgtattacaaccaattgtcaaa
tcaaaaagcattccaaatattcctgatttagtccttgagctgattctagcttggaccgaa
aacggctgtcttgaattcaaaagttggaagggcttcttaggagatgtgctaaacgatact
gacttcttcaaagttcagccttcacagcgggaatattgggataggatatttgtcaagtat
attggtgctgagtcagagaaaatggctgagcttgttactaagttccaaagcctcaacaat
agcaacaacttgtttaattggaacgatgcagaaataaggggtcgctcgttgctggtaaaa
agaatatgctacttgatactaattggtcctcaggatactttcatggattcgttgaaagaa
attatgttcaggttgaatgaaattataaaagattcaaccatgaagccactgctgtttctc
acgctcagaatattggtactaaagtttagtcctattcacctctcaccttattggactttg
attgttagtcagatggaggaattgctgctcgatgttttggagaagtcaacacttcttgat
ggggctgttgaaaaagatcacaatcatggaaatggtaaacataaacttagaaaagaggct
gccaggccagagctggaaatcgatctagattctttattgagtggatgcaagctgttggat
gttttaataatgatgaagccagaagagttccagctgtcggaatggctgtttattcaagac
tctgctttatcacagtcagacgataagactgacacagcaataccagcattaattgagaga
ttgtcccatattaaggacctgaatcgttactctgtgctaaaatctctcaattatgagcta
acggagaaaaccaggagaaagccattgttggaaggaataaacactatcgacaatatagga
gaactaaaagagtttttcgatagtttgagcttccatgactttgagtgcaactacaatatc
aatgcacctgattatgatgcccccatagcagacagttttgctgatgtctttgaggcatct
accttcgaataa

DBGET integrated database retrieval system