KEGG   Komagataella phaffii: PAS_chr2-1_0343Help
Entry
PAS_chr2-1_0343   CDS       T01092                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ppa  Komagataella phaffii
Pathway
ppa00250  Alanine, aspartate and glutamate metabolism
ppa00410  beta-Alanine metabolism
ppa00430  Taurine and hypotaurine metabolism
ppa00650  Butanoate metabolism
ppa01100  Metabolic pathways
ppa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PAS_chr2-1_0343
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PAS_chr2-1_0343
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PAS_chr2-1_0343
   00430 Taurine and hypotaurine metabolism
    PAS_chr2-1_0343
Enzymes [BR:ppa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PAS_chr2-1_0343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 8199031
NCBI-ProteinID: XP_002491242
UniProt: C4R0D8
LinkDB All DBs
Position
2:638596..640089
Genome map
AA seq 497 aa AA seqDB search
MTPIKTDLEADRVTELETLLRPAVELIAQHIKDTDENDKPIGPYYPNPRDLYQSLKLEAD
FNGGGKDDELVIQTVKKVLDSSVNTWNAGFMDKLYASTNVIGLVSDLLLSALNTNSHVFT
VSPAVTIIEKYTARQYAGLFGFLGPRAGGLTFPGGSWSNVTSLQMARSSLYPDTKVKGNG
NHHFAVFASSHSHYSVEKACILLGIGAENLFKCKVDKNGCMDVTDLRVNIEKSIAEGYTP
LYINATAGTTVFGSYDSFEDIHKIAKEYKCWFHIDGSWGGNVIFSDREKHKMKGSHLADS
ITANPHKMLGVPCTCSFLLVPDVSIFQQANSLNAPYLFHNKHEDDDENYDLADGTMGCGR
RADSLKFYLSWLYYGSEGYKERVDHAFSIARYFTSKIVNRKGFKLVGSPEPACLQVCFYY
NPKNDFENGSENTNATRYIATELHKHGKFLVDYSPNPDDVDNQHGEFFRVVFNSPILDDK
TIDSLIDLIEQTGEEIV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacacccataaaaactgacctagaagctgatagagttactgaactggagaccttactt
agaccagctgtcgagttgatagctcaacatatcaaagacactgacgagaacgataaacca
attggcccctactatcccaacccaagagacctctaccaatcattaaagcttgaagcagac
tttaatggtggcggaaaggacgatgagttagtaattcaaacagtcaagaaagttttagac
tcttcggtaaacacatggaatgcagggttcatggacaagctctatgcttccacgaacgtg
atcggattagtaagtgatctcttattgagtgctttgaatacaaactctcatgttttcaca
gtatctcctgctgttaccataatagagaaatacactgctagacagtatgctggacttttt
ggatttttaggacccagagctggagggttaacttttccaggtggatcctggtctaatgtt
acttcactccagatggcccgaagcagcttataccccgatacaaaagttaaaggtaacggg
aatcatcattttgctgtatttgcatcatctcattcacattatagtgttgaaaaagcatgt
atcctgttgggaattggggctgagaatttgttcaagtgtaaggtggacaaaaatggttgc
atggatgtgacagatctcagagtgaatattgaaaaatccattgctgaaggttacactccg
ttatatatcaatgccacagctggcacaactgtttttggctcgtatgactcatttgaagat
attcataagatagccaaagaatacaaatgctggttccacattgatggttcttggggtggt
aatgtcattttcagtgatagggagaaacataagatgaagggaagccatttggcagactca
atcactgctaacccgcataaaatgttgggtgttccatgcacatgttcctttcttctagtt
ccagatgtctctatattccaacaggccaactccttgaatgcaccctatttattccataat
aaacacgaagatgacgatgaaaattacgatttagcagatggaactatgggttgtggcaga
agagcagatagcttgaaattttatctctcatggctttattatggttctgaaggttataag
gaaagggtagatcacgccttctccattgccagatattttacttccaagattgtcaatcgt
aaaggtttcaaactggtgggcagtcccgaacctgcctgtttgcaagtttgtttctactat
aatccaaaaaatgatttcgaaaatgggtcagaaaacacaaacgctactagatacattgcc
acagaattgcataaacatgggaagtttttggtagactattcgccaaaccctgatgatgtt
gacaaccagcatggagagttttttagagttgtttttaattctccaattctagatgacaag
acgatagattccttgatagatctgatagaacagactggagaggaaatcgtttga

DBGET integrated database retrieval system