KEGG   Komagataella phaffii: PAS_chr2-2_0084Help
Entry
PAS_chr2-2_0084   CDS       T01092                                 

Definition
(RefSeq) Repressible alkaline phosphatase, a glycoprotein localized to the vacuole
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ppa  Komagataella phaffii
Pathway
ppa00730  Thiamine metabolism
ppa00790  Folate biosynthesis
ppa01100  Metabolic pathways
Module
ppa_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ppa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PAS_chr2-2_0084
   00790 Folate biosynthesis
    PAS_chr2-2_0084
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppa04147]
    PAS_chr2-2_0084
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ppa00537]
    PAS_chr2-2_0084
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PAS_chr2-2_0084
Exosome [BR:ppa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PAS_chr2-2_0084
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ppa00537]
 Enzymes
  PAS_chr2-2_0084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Frankia_peptide
Motif
Other DBs
NCBI-GeneID: 8198264
NCBI-ProteinID: XP_002492125
UniProt: C4R2X1
LinkDB All DBs
Position
2:complement(2225270..2226847)
Genome map
AA seq 525 aa AA seqDB search
MDSEPLLPNPNDSRKPANWRRIIKYISLTLAWIGIFSYVYIYHGTASKLTPTKKNVIFMV
TDGMGPASVTVARDFKQFKYDLSWDEQLFIDTYLVGSSRTRSFDSWVTDSAAGATAFSCR
SKTGNNMVAVDYDSKPLGTVLEAAKLQGFKTGISVTTYVSDATPAAFASHSVTRWNADLI
TKHLLGDYPLGRSLDLMVGGGRCFFYGRKDGGCRYDGENLLKTAKHSGWNLLENKTAFDA
LGENNAPVDLPLMVLLAEGNFPFEIDRNASEHPSIGEQTHKVLDILDKATKKDDQGFFVL
IEGSRIDHAGHYNDAAAQVQEVLAFDEAFQAAVEFADDSSVETLIISVSDHETGGLSAAK
QVTPNYPDYAWFPEVLLNVTHSSEYLAAKLSNYKETDLLSFIEEDILQDGMGIYDATPEE
IQAIKKARHKSLDVLSKIISKRAQVGFSTHGHSAVDVNIYAHGNTPALQKRIDKYLRGNH
DNTDIGKFMESWLRVDLDEVTAQLEGLSVGEGSHYSSFGVEQHPL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggactctgagcctctactgccaaatcccaatgatagcagaaagccagccaattggagg
agaattataaagtatatctcattaacattagcttggattggtatcttttcttacgtttac
atctaccatggcacggcgtcaaaattaacccccacaaaaaagaatgtaatctttatggtc
actgatggaatgggtccagcatctgttactgtagcccgtgactttaaacagttcaagtat
gatctttcatgggacgaacaactattcattgacacgtatctcgtgggctcttccagaacg
cgctcctttgattcctgggttacagacagtgccgccggcgcaacagcctttagctgcaga
agtaagactggaaataacatggtagccgtggactacgattcgaagcctctgggaacagtg
ctggaagccgctaaactacaagggttcaagactggtattagcgttactacttacgtttcg
gacgctacaccagctgcatttgcctcgcattcggttactcgttggaatgctgacttgatt
acaaagcacctattgggagactatcccttggggaggtcattggatcttatggttggtggt
ggccgttgtttcttttatggtaggaaagatgggggctgcagatacgatggtgagaaccta
ttgaaaactgctaaacacagcggttggaacctactcgagaacaaaaccgcatttgatgcc
ctgggagagaacaatgcacccgtagatctaccactgatggtattgttggccgaaggaaac
tttccgtttgagatcgaccgtaatgcatctgaacatccgtcaatcggagaacaaacacat
aaagtcctggatattctcgacaaagccactaaaaaggatgatcaaggtttttttgttttg
attgaaggatctagaattgaccacgcgggtcattacaatgatgccgctgcgcaagtgcaa
gaagtattagcattcgatgaagcattccaagcagccgtagaatttgctgacgattcatcg
gtggagacattgattatctccgtgtcggatcatgagacagggggtctatccgcagccaaa
caagtcaccccgaattatcctgattatgcgtggtttccggaagtactgctaaatgtgaca
cattctagtgagtaccttgccgcaaaattgagcaattacaaagaaactgatcttctctca
tttatcgaagaggacatcctccaagatggaatgggaatctatgacgccactcctgaagag
atccaagctattaaaaaggctcgccataaatctctggatgttctgtcaaaaataatttcg
aaaagggcacaagtggggttttcgacccatggccattcagccgtagacgtgaacatctat
gcacatggaaacacccccgccttacaaaaaagaatcgacaaatacctgcgcggaaaccat
gataatactgatattggaaaatttatggaaagctggttgcgtgtagacctcgatgaggtg
acagcacaactagagggtctatctgttggggagggcagtcattatagctcgttcggggta
gagcagcaccctctttag

DBGET integrated database retrieval system