KEGG   Komagataella phaffii: PAS_chr3_0236Help
Entry
PAS_chr3_0236     CDS       T01092                                 

Definition
(RefSeq) Elongase
  KO
K10246  fatty acid elongase 3 [EC:2.3.1.199]
Organism
ppa  Komagataella phaffii
Pathway
ppa00062  Fatty acid elongation
ppa01040  Biosynthesis of unsaturated fatty acids
ppa01100  Metabolic pathways
ppa01110  Biosynthesis of secondary metabolites
ppa01212  Fatty acid metabolism
Module
ppa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ppa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    PAS_chr3_0236
   01040 Biosynthesis of unsaturated fatty acids
    PAS_chr3_0236
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ppa01004]
    PAS_chr3_0236
Enzymes [BR:ppa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     PAS_chr3_0236
Lipid biosynthesis proteins [BR:ppa01004]
 Elongase
  LCFA
   PAS_chr3_0236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-GeneID: 8199985
NCBI-ProteinID: XP_002492452
UniProt: C4R3Y7
LinkDB All DBs
Position
3:complement(475354..476346)
Genome map
AA seq 330 aa AA seqDB search
MSDINTLSQKIPSYVQYGIPSIDHPFGIRLWPIFSHFFEAVVGYPAEDFRFIQGLTTMAN
LKDALGVIAVYYFVIFGGQWLMRTLNARPFKLNFLFQLHNLVLTGASFTLLILIVEQLIP
GIYRHGIFWAICHKDSFTNELVTLYYLNYLIKYVELIDTVFLVLKRKKLLFLHTYHHGAT
ALLCYTQLLGHTAVEWVPIALNLAVHVVLYWYYFLSARGIRVWWKQWVTRFQIIQFLIDL
GFVYFATYTFYADKYFPELPNMGTCYGTEEAAAFGYLILTSYLVLFILFYIRVYKSGPTT
SKGKSKAAATTGQKTETASPSGKSTSVRRA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacattaatactctgtcgcagaagattccgtcgtatgttcaatacggtattccc
agtattgatcatccttttggaatccgtttatggccaattttcagtcatttctttgaagcg
gttgttggatacccggctgaagatttccgctttattcagggtctgactaccatggccaat
ctaaaagacgccctcggtgttattgctgtttattactttgtgatttttggtggacaatgg
ttgatgaggaccctgaacgctcgtcctttcaagttgaatttcttgtttcaattgcacaat
ttggttttgaccggggcgtcgtttaccttgttgatattgatcgtggaacagttaatccca
ggtatttatcgccatggaatattttgggctatttgccacaaggattctttcaccaacgaa
cttgtcacgctatattacctgaactacttgatcaagtacgtggagttgatcgataccgtg
tttttggtcctgaaacgcaaaaagttacttttcttgcacacttaccaccatggtgccact
gcattactatgctacacccagctactcggacacactgccgtcgaatgggtcccaattgcc
ctgaatctggctgttcacgtcgtcttgtactggtactacttcctctctgcacgtggaatt
cgtgtatggtggaagcaatgggtgaccagattccaaattattcagttcttgatcgaccta
gggtttgtctactttgctacctataccttctacgctgacaaatacttccccgagctaccc
aacatgggaacatgttatgggactgaggaagctgctgctttcggatacttgatcctcaca
tcgtatttggtcctattcattctcttttacattcgtgtctacaagtccgggcccacaaca
agcaaggggaaatcaaaggcagctgctactaccggtcaaaaaactgagactgcctcccct
tctggcaaaagcactagtgtccgtcgtgcctaa

DBGET integrated database retrieval system