KEGG   Komagataella phaffii: PAS_chr3_0482Help
Entry
PAS_chr3_0482     CDS       T01092                                 

Definition
(RefSeq) Putative alanine transaminase (glutamic pyruvic transaminase)
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
ppa  Komagataella phaffii
Pathway
ppa00220  Arginine biosynthesis
ppa00250  Alanine, aspartate and glutamate metabolism
ppa01100  Metabolic pathways
ppa01200  Carbon metabolism
ppa01210  2-Oxocarboxylic acid metabolism
ppa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PAS_chr3_0482
   00220 Arginine biosynthesis
    PAS_chr3_0482
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ppa01007]
    PAS_chr3_0482
Enzymes [BR:ppa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PAS_chr3_0482
Amino acid related enzymes [BR:ppa01007]
 Aminotransferase (transaminase)
  Class I
   PAS_chr3_0482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 8199609
NCBI-ProteinID: XP_002492709
UniProt: C4R4P4
LinkDB All DBs
Position
3:915864..917396
Genome map
AA seq 510 aa AA seqDB search
MRVNKFIRPCRHMSSTTVVSLGLKIKPDFQPAPKLTVTDLNPHTVNAKYAVRGKIPTKAE
LLRNQLNDVDHKLPFTKIISANIGNPQQLDQKPLTFYRQILALLQYPPLLDDPRVASIFP
KDIIERARSLLKQIGSVGAYSQSQGVPSIRQSIADFISRRDGHPCARKELIYLTTGASTA
VTYLLTLLGQNEKTGFLIPIPQYPLYTATLTLNNRTALPYYLNEEDNWSIECDEIESIIL
DSKAKGIDPRCLIVINPGNPTGAILSYEAIEDILNVCAKYGLVVIADEVYQENIFDGKFI
SVRKVLLDLLQGPKADLYKNIQLASLHSTSKGISGECGQRGGYMELIGFDESVLEQITKL
SSISLCPVVTGQALVELMINPPKEGDESYKLYYDETRAIHDSLAERATKLYDAFNSMEGV
VCRKPQGAMYCFPKITIPEKAIKTAKELDFEPDEFYCNELLETTGICAVPGSGFGQKPGT
YHIRTTFLAPGSEWINDWVVFHKKFMQKYK
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgagagttaataaatttattcgtccttgtcgtcatatgtcttcgacaactgttgtttcg
ttggggctgaagatcaaaccagattttcagcccgcaccaaagttgaccgtcactgatttg
aaccctcatacagtcaatgccaaatatgccgtaagaggaaaaattcctactaaggcagaa
cttttaagaaatcagcttaacgatgtagaccataaattgcctttcaccaaaattattagt
gccaacattggtaatccacagcaattagaccaaaagccattaacattctacagacaaatc
ctggccctgctgcagtacccgcccttgttggacgatcctcgtgttgcttcaattttcccc
aaggatattattgagcgtgctagaagcttattgaaacaaattggttccgtgggtgcctac
tcccaatctcaaggtgtcccttctatcagacagtctatcgcggacttcatcagcagaaga
gacggccatccttgtgccaggaaagagctaatatatcttaccaccggtgcatccaccgct
gtcacttatctgttaactctactgggacaaaatgagaagaccggtttcttgattccgatt
cctcaatatcctctctatactgccacactgaccctcaacaaccgtaccgcattgccatac
tacttgaacgaggaagacaactggtccatcgagtgcgatgaaatagagtccattattctg
gattccaaagctaaaggaatcgaccctcgttgcctgatagtaatcaatcctggaaacccc
actggtgccattctttcctatgaagccattgaggatatcttgaatgtttgtgccaagtat
ggtttggttgttattgccgatgaagtgtatcaggaaaacatttttgacggtaagttcatt
tccgttagaaaagtgttgctagatctattacaaggcccaaaggccgacttgtataagaac
atccagttggcatcgttgcattcgacctccaagggtatttctggagaatgtgggcaaaga
ggtggctatatggaactcataggtttcgacgaatctgtgttagaacagatcaccaagctt
tcttctatttctctgtgcccagtggtgacaggccaagctctggtagaactaatgattaac
ccgcccaaggaaggagatgaatcttacaaactgtattacgatgagacccgtgctattcac
gattccctagccgaaagggccacgaaattgtacgatgcgttcaacagcatggagggtgtt
gtttgccgcaaaccccaaggggccatgtattgtttccccaaaatcactattcctgagaag
gcgatcaagaccgccaaggagcttgactttgaacctgatgaattttactgcaatgaattg
ttagagactactggtatttgtgctgttccaggctccggatttggacagaagccgggaaca
tatcacattagaacaactttccttgctccagggtccgagtggatcaacgactgggtcgtc
ttccacaagaagttcatgcaaaagtataaatga

DBGET integrated database retrieval system