KEGG   Komagataella phaffii: PAS_chr3_0500Help
Entry
PAS_chr3_0500     CDS       T01092                                 

Definition
(RefSeq) hypothetical protein
Organism
ppa  Komagataella phaffii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding_2 Flg_new Nudix_hydro
Motif
Other DBs
NCBI-GeneID: 8199869
NCBI-ProteinID: XP_002492727
UniProt: C4R4R2
LinkDB All DBs
Position
3:955489..955899
Genome map
AA seq 136 aa AA seqDB search
MAFFGNRTYLVVGASKNPEKYGYKVLKWYLDRNLNVVPINPTTPEVLGAKTKSSILEALA
NGHEYSLSVITPPDVSYNSLKEVLESVKGDLVKSIWFQPNSYDEKLISYLNKKGFYKNKG
NLIYNDCILVSGDSKI
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcattttttggtaatagaacatacttggtagttggagcttctaagaatccagaaaag
tatggctataaagttcttaaatggtacttggaccgaaatttgaatgtcgttccaataaac
cccacaaccccagaggtattgggtgccaaaacaaaaagttcaatcttggaggcgcttgca
aatggccatgaatattccttgtccgtaatcacgccaccagacgtatcttacaactcattg
aaagaggtgcttgagtcagtgaaaggagatttggtaaaatctatttggttccagccaaac
tcttatgacgaaaagttgatttcgtatctgaacaagaaagggttctataagaacaagggt
aacttgatttataatgattgtatattggtttcaggagattctaaaatatga

DBGET integrated database retrieval system