KEGG   Komagataella phaffii: PAS_chr3_1111Help
Entry
PAS_chr3_1111     CDS       T01092                                 

Definition
(RefSeq) Iron-sulfur protein subunit of succinate dehydrogenase (Sdh1p, Sdh2p, Sdh3p, Sdh4p)
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
ppa  Komagataella phaffii
Pathway
ppa00020  Citrate cycle (TCA cycle)
ppa00190  Oxidative phosphorylation
ppa01100  Metabolic pathways
ppa01110  Biosynthesis of secondary metabolites
ppa01130  Biosynthesis of antibiotics
ppa01200  Carbon metabolism
Module
ppa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ppa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ppa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAS_chr3_1111
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PAS_chr3_1111
Enzymes [BR:ppa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PAS_chr3_1111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 Fer4_18 Fer4_9
Motif
Other DBs
NCBI-GeneID: 8200068
NCBI-ProteinID: XP_002493357
UniProt: C4R6J2
LinkDB All DBs
Position
3:2149185..2149988
Genome map
AA seq 267 aa AA seqDB search
MLTHTVLRAGTKRTCSTLSVVRGLATVSQNQPRLKSFKVYRWSPDTPEIKPHMQEYKIDL
NECGPMVLDALLKIKNEQDATLTFRRSCREGICGSCAMNIGGRNTLACLCKIDQNESTEL
KIYPLPHMFVVRDLVPDLTHFYKQYKSIQPFLQRDSVPSDGKENLQSIEDRKKLDGLYEC
ILCACCSTSCPSYWWNQQEYLGPAVLMQAYRWLIDSRDQASVARKEMLQNSMSLYRCHTI
MNCARTCPKGLNPGKAIAEIKKQLAFD
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcttactcacacagtattgagagctggaactaagagaacctgctctaccctttctgtc
gtcagagggttggccacggtctcgcagaatcaacccaggctgaagtcattcaaagtgtat
cgttggtctcctgatacgccggaaattaagccacatatgcaagaatacaagattgatctg
aacgaatgtggtcccatggttttggatgctttgctcaagatcaagaacgaacaggatgct
acacttaccttccgtagatcgtgtcgtgagggtatttgtggatcatgtgctatgaacatt
ggtggtagaaacactttggcatgtttatgcaagatcgaccagaatgagagcacggaactc
aaaatttatcctcttcctcacatgtttgtagtccgagacctagtgcctgatttaacacac
ttttacaagcaatacaaatcgatccaaccatttttacaaagagattcggtgcctagcgat
ggcaaagaaaatttacaatctattgaggatcgtaagaagttggatggattgtacgagtgt
atcttgtgtgcctgctgttctacgtcttgcccgtcttattggtggaatcaacaggaatat
ttaggccccgcggttttaatgcaagcctatagatggttgatcgattcccgtgatcaagct
tctgtggcaagaaaagaaatgttgcagaattcaatgtcactataccgctgtcacacaatc
atgaactgtgctcgtacttgtccgaaaggcttgaatccaggtaaagccattgcggaaatc
aaaaaacagcttgcctttgactaa

DBGET integrated database retrieval system