KEGG   Komagataella phaffii: PAS_chr3_1112Help
Entry
PAS_chr3_1112     CDS       T01092                                 

Definition
(RefSeq) DNA ligase found in the nucleus and mitochondria
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ppa  Komagataella phaffii
Pathway
ppa03030  DNA replication
ppa03410  Base excision repair
ppa03420  Nucleotide excision repair
ppa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PAS_chr3_1112
   03410 Base excision repair
    PAS_chr3_1112
   03420 Nucleotide excision repair
    PAS_chr3_1112
   03430 Mismatch repair
    PAS_chr3_1112
Enzymes [BR:ppa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PAS_chr3_1112
    6.5.1.6  DNA ligase (ATP or NAD+)
     PAS_chr3_1112
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PAS_chr3_1112
DNA replication proteins [BR:ppa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PAS_chr3_1112
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PAS_chr3_1112
DNA repair and recombination proteins [BR:ppa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PAS_chr3_1112
   NER (nucleotide excision repair)
    Other NER factors
     PAS_chr3_1112
   MMR (mismatch exicision repair)
    Other MMR factors
     PAS_chr3_1112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 8200069
NCBI-ProteinID: XP_002493358
UniProt: C4R6J3
LinkDB All DBs
Position
3:2150267..2152501
Genome map
AA seq 744 aa AA seqDB search
MTHCGPLLFPNLDLSRNLSKRLFLCYISYYNCFIMSGQQSLNRFFSARKPEIVNSTSKKL
ISQKRTTETDYSPLKRTKNSTMLECGDLNSPHLAKVGYPDLEKDTVDSNILVEAESLLKL
ESKYHSDSPDLPQSQEIFYSSLTNIFEKLEQEPARLKNLAIASEFFLQILRSNHKRTLVE
VIYLMINRLGPDYELDLELGLGETLLVKAIAEGTGRTPQRIRSELHKLGDIGLVAQNSRS
RQPTMFKSKPLTIHSVFENLTKIAKSSGNASQARKIGLINQMLTTCEGSEAKFLMRSLEG
KLRINFGEKSVLVALSKAFSEYEHELSSKKGHVSPQELVDAEEAIKKAFSQIPNYEIIVD
EALKYGISNLATHCTLKPGIPLKPMLAKPTKSITEVLDHFHGQEFTCEYKYDGERAQLHV
QEDGTVKIYSRNSEDMSQRYPDLIDVVSQIKTQCNGVITLILDCECVAWDGEKGKILPFQ
VLSTRKRKDVNAKDIKVQVCLFAFDILFLNGKSLLELPLKERRKILHENVKPIEGKFQFA
EAMDADNVAEIQHFLDQSVKDSCEGLMVKMLDGDKSHYEPSKRSVNWLKLKKDYLEGVGD
SLDLAVVGGYIGKGKRTGWYGGFLLACYNEDSGEYETCCKIGTGFSEEMLQTLSGTLKPT
VIQQPKPFYVYDASPDVWFEPTLVFEVLTADLSLSPVYKAGINFFGKGVSLRFPRFIRVR
DDKSPEQATSSDQIVELYQKQAHV
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgacacactgtgggccactcttgtttcccaatcttgacttatctaggaatttatcaaaa
aggctttttttgtgctatatttcatactacaactgttttataatgagcggccaacaatcg
cttaatcgtttttttagtgccagaaaacctgaaatcgttaattcaacttccaagaagcta
atatcgcaaaaacgaactacagagactgactattctcctttgaagcgaaccaaaaactca
actatgctagaatgtggtgacctaaattctccccacttagcaaaggttggctatcccgat
ttggaaaaggacactgttgattcaaatattttggttgaagctgagagcttgctaaaacta
gagtccaaataccattctgacagtcctgatcttccccaatcacaggaaattttttacagt
tcgttgacaaatatttttgaaaaactagagcaagagcctgccaggctgaaaaacctagca
attgccagcgagttttttcttcaaatattgcgatcaaaccataaacgtactctggtggag
gtaatataccttatgattaacaggttgggaccggattatgaattagatttggagctgggt
cttggcgaaacgttgcttgtaaaagctattgctgaaggcaccggcagaacacctcaacga
attagatcagagcttcataagcttggtgacatcggacttgtagcccaaaattcaagatca
agacagcctactatgtttaaatcaaaacccctcactattcattctgtgtttgaaaacttg
actaaaattgctaagtcttcaggaaatgcatcacaagcccgaaaaattgggttaattaat
cagatgttaactacgtgtgaaggatctgaagctaaatttctaatgagatctttggaggga
aagcttagaattaattttggtgagaaatctgtgttggttgcgttatcaaaagcgttttct
gagtacgaacatgaattgtcaagcaaaaagggccacgtaagccctcaggagttagttgac
gcagaagaagccattaaaaaggcttttagtcagattccaaactatgaaattattgtcgac
gaagctttgaaatatggaatatccaaccttgctacacattgtacattgaagcctggtatt
ccccttaagcctatgttggcaaagccaacaaaatccataactgaagtcttagaccatttt
cacggtcaagaatttacatgtgagtataagtacgacggcgaacgcgcgcaattacatgtt
caggaggacggtactgtgaagatatactctaggaattctgaagacatgagtcaaaggtat
ccagatttaatagacgttgtcagccaaataaaaacccaatgcaacggagtaattacgttg
atcttagattgcgaatgtgttgcatgggatggtgaaaagggcaaaattttacccttccag
gttctctctacgagaaagcgtaaagatgtaaatgccaaagacattaaggtccaagtttgt
ctgtttgcatttgacatacttttcttaaatggcaaatcgcttttggaacttcccttaaaa
gagcgaaggaaaatacttcatgaaaatgttaagcctatcgaaggaaaatttcagtttgca
gaagccatggatgcagataatgttgcagaaatacaacattttttggatcaatcagtgaaa
gattcatgtgaaggtctgatggtaaaaatgttagatggagataaatcacattacgaacct
tcaaagagatctgtcaattggttaaagctaaaaaaagactacttggaaggtgttggcgat
tctttagacctagcagttgtgggagggtatataggaaagggtaaaagaactggatggtat
ggcggcttcttattagcctgttacaacgaagacagtggtgaatatgaaacttgctgtaaa
atagggactggatttagtgaagaaatgcttcagacgctgtctggcacgttaaaaccaacc
gttattcaacaaccgaaacctttctacgtttacgatgcatcgcctgacgtctggtttgag
ccaacactagtttttgaagttttgactgccgacttgtccctctctcctgtgtataaggca
ggaatcaacttcttcgggaaaggcgtttctttgcgttttccgaggtttatacgggtcaga
gatgataagagcccagaacaagctaccagcagtgatcaaattgtggaattataccagaaa
caagctcatgtttaa

DBGET integrated database retrieval system