KEGG   Komagataella phaffii: PAS_chr4_0579Help
Entry
PAS_chr4_0579     CDS       T01092                                 

Definition
(RefSeq) Intracellular sporulation-specific glucoamylase involved in glycogen degradation
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
ppa  Komagataella phaffii
Pathway
ppa00500  Starch and sucrose metabolism
ppa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAS_chr4_0579
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PAS_chr4_0579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 8200844
NCBI-ProteinID: XP_002494017
UniProt: C4R8B3
LinkDB All DBs
Position
4:1131823..1133535
Genome map
AA seq 570 aa AA seqDB search
MKLLDGLTISLCISMATSLVLPGFDQLRLQQQNVLSLLPKEKIQIQTLSEIWSYVDCAIA
SLGPKEIVIDSDLSILKPVQASSIPRSEFNQWLLYQRNVSFHGVLNNIGGYGYNADNVSV
GCIIASPSKSSPNYFYQWVRDSAITINTVIEYLYDDNIDDSIDKSELLEAIDGYINNIHH
LQRQDNRSGKFKDGYASLGEPKFMVNGDPFNDSWGRPQRDGPGLRALSVANYIDLLDKLG
IQKDSERLSFIYNEVLKPDLTYVTLYWDHDGFDLWEETNGLHFFTSLTQLKALRRGIELA
LRFEDYEFHRDLKNAYAQLRNFIVGRDSGFQDPRFPHIIEHPNLVDAPAHIRRNGLDIAT
IIAALRSHDVDDAGDIVNIPFGVDNARVLNSLTYLVNDMKFRYPLNQGRIVPGLTLGMAL
GRYPEDTYNGVGTSEGNPWFISTSSAGELIYKLLYLQYKYQQDFVIDSSNREFYEMFLDL
PKDSARGIQIRIPFGSDTYRALSVSLIQYADSFLDVIREHVDNEGQMSEQFNRYNGYMQG
AEKLTWSFGSVWSCLRWRNRILNLLATINE
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaagctattagacggcttgacaatatctttgtgcataagcatggccacctcgctggtg
ttgcctggctttgaccaacttagattacagcagcaaaatgtattatcgttactcccaaag
gaaaaaatccagatccaaacactctcagagatctggtcttatgtggattgcgctattgcc
tccttgggaccaaaggagatcgttatcgactcagacttgtcgattttgaagcctgtccag
gcttcttctatccctagatcagaatttaatcaatggttgctctaccaacgaaatgtctca
tttcatggtgtgctcaacaacatcggaggatacggctataacgcagacaacgtttctgtg
ggatgcattatcgcctctccttcgaagtcttctccaaactacttctatcagtgggttcgt
gatagtgcaatcactatcaacacagtgatagagtatttgtatgacgacaacatagacgat
tctatagacaaaagtgagcttttagaagccatagacggctacatcaacaacattcatcac
ttacaacgtcaggacaatagatctggtaagttcaaagatggctacgccagtctgggagag
ccaaagtttatggtcaacggtgaccccttcaatgactcttggggacgtccccagagggat
ggaccaggacttcgtgcactatccgtggccaactatattgatctgctggataagctggga
attcagaaagattcagaaagactctcattcatctacaatgaagtattgaagccagatctc
acttatgtcaccctctattgggaccacgatggatttgacctgtgggaagagactaatgga
ttgcattttttcactagtttgactcaactgaaggctcttagaagaggtattgaactggct
ctcaggtttgaggactacgaattccatcgtgacctgaagaatgcttatgcccaactaaga
aactttattgttggtagagactctggattccaagatcctcgtttccctcatatcattgag
caccctaatttggtagacgctccagcccatattagaagaaatggtttagatatcgcaacc
atcattgctgcgctgagatctcacgatgttgatgatgcaggcgatatagtcaacatcccg
tttggcgtggacaatgcaagggtcctcaattccctgacctatttggttaatgacatgaag
ttccggtatccactcaaccagggtcgtatcgtccctggtttaactctaggaatggcctta
ggaagatatcctgaagacacctacaacggtgttggtaccagtgaaggaaatccatggttc
atttcaacttccagtgcaggtgaactcatctacaagctgttgtatttgcaatacaaatat
caacaagacttcgtgatagattcttccaatagggaattctacgaaatgtttttggatctg
cccaaagactctgctcgtggaattcaaattcgcatacctttcggaagcgacacctatcgt
gcactgtccgtttctttgatccaatatgcggattccttcttggacgtgatcagggaacat
gtggataacgaaggtcaaatgagtgaacaatttaacaggtacaatggttatatgcaagga
gccgagaaattaacttggagttttggttctgtttggagttgtctccgttggaggaacaga
atactaaacttacttgcaacaattaatgaatag

DBGET integrated database retrieval system