KEGG   Palaeococcus pacificus: PAP_00300Help
Entry
PAP_00300         CDS       T03210                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ppac  Palaeococcus pacificus
Pathway
ppac03030  DNA replication
ppac03410  Base excision repair
ppac03420  Nucleotide excision repair
ppac03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ppac00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PAP_00300
   03410 Base excision repair
    PAP_00300
   03420 Nucleotide excision repair
    PAP_00300
   03430 Mismatch repair
    PAP_00300
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppac03032]
    PAP_00300
   03400 DNA repair and recombination proteins [BR:ppac03400]
    PAP_00300
Enzymes [BR:ppac01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PAP_00300
    6.5.1.6  DNA ligase (ATP or NAD+)
     PAP_00300
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PAP_00300
DNA replication proteins [BR:ppac03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PAP_00300
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PAP_00300
DNA repair and recombination proteins [BR:ppac03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PAP_00300
   NER (nucleotide excision repair)
    Other NER factors
     PAP_00300
   MMR (mismatch exicision repair)
    Other MMR factors
     PAP_00300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C Peptidase_S7
Motif
Other DBs
NCBI-ProteinID: AIF68507
UniProt: A0A075LRA3
LinkDB All DBs
Position
complement(54162..55841)
Genome map
AA seq 559 aa AA seqDB search
MKYKELAELYRNLEKTSSKILKTKFVAEFLKSVEKPELLEIIPYMILGKVFPDWDERELG
VGEKLLIKAVSMATGIDAKEIEESIKDTGDLGESVALALKKKKQKSFFAQPLTIERVYKT
LVKVAETSGERSQDRKLKLLANLFMDASPEEGKYLARTILATMRTGVAEGLLRDAISEAF
KVKVELVERAFMLTSDFGYVAKVAKLEGNEGLSKVHIQVGKPIRPMLAQQAPSVKDALLE
MGGKVEFEIKYDGARVQVHKDGNEVVIYSRRLENVTKSIPEVVERVRKAIKAERAIIEGE
LVAIGEEGRPKPFQFVLRRFRRKYNIEEMIEKIPLELNLFDALYIDGEGLIDLPLKERRT
RLESIVEESESIKLAQKLVTQNVEEAERFYNEALKMGHEGLMAKRLDSVYEPGNRGKKWL
KIKPTMENLDLVIIGAEWGEGRRAHVFASYLLGAYDPERGDFVPVGKVGSGFTDEDLLEF
TKMLKPLIIKEEGKEVVIEPKVVVEIAYQEIQKSPKYESGFALRFPRYVSLREDKSPEEA
DTIEKVAQLYELQERMRGK
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaagtataaagaactcgctgagctttatagaaacttagaaaaaacctcatcaaagata
ctaaagacaaagtttgtagcagagtttttaaagagcgttgaaaagcccgagctcttggag
ataatcccatatatgattcttggaaaagtctttcccgactgggatgaacgcgagcttgga
gtcggtgaaaagctcttaattaaagcagtttcgatggctacaggcattgatgccaaagag
attgaggaatcaattaaggatacgggcgatttaggagagagtgttgctctagccctgaag
aaaaagaagcagaaaagcttctttgctcagcccttaaccatagagcgcgtttataaaacg
ctcgttaaagttgcggaaacgagcggagagagaagccaagatagaaagctcaagctttta
gccaatctctttatggacgcttctcccgaagaaggaaagtatttggcgagaactattcta
gcgactatgagaacgggagttgctgaaggccttttgagagatgcaataagcgaggccttc
aaagttaaagttgagctggtcgagagagctttcatgctcacaagcgactttggatacgtg
gctaaggtggcaaaacttgaaggaaacgaaggcctctccaaagtgcacattcaagttgga
aagccaatacgaccaatgctggctcagcaggcaccaagcgtgaaagatgctctactcgaa
atgggcggcaaagtcgagttcgagataaagtacgatggggcgagggtgcaggtgcataaa
gacggcaatgaagtggtgatatactcaaggagactggagaacgttaccaaatcaattccc
gaagttgtggagagagttagaaaggccataaaggccgagagggcaataattgaaggcgag
cttgttgctataggtgaggaaggaagacccaaaccgttccaattcgtcttaaggcgtttc
aggcgcaaatataatatagaggagatgattgaaaagattcctctcgagctgaacctcttt
gatgccctctacattgatggggaaggattgatagatttgcctctaaaggagcgtagaaca
aggcttgagagtattgtagaggagagcgaaagcataaagcttgctcaaaagctcgtaaca
caaaatgtcgaagaagctgagcgcttctataatgaggctctaaagatggggcatgagggc
ttaatggccaaaaggcttgactcagtttatgagccaggaaacagaggtaagaagtggctt
aagattaaaccgacgatggaaaaccttgatttagtaattatcggagcagaatggggcgaa
ggaagaagggcgcatgtgtttgcatcctatctccttggagcctacgacccagagcgcgga
gacttcgtccctgtcggcaaggtagggagtggcttcacagacgaagacttgttggagttc
acgaaaatgcttaagcccctcataataaaagaagaaggcaaagaagttgtgatagagcct
aaagtggtcgtggagatagcatatcaggagattcagaagagtccgaagtatgagagcggc
tttgcattgagattcccgcgctacgtaagcctcagagaagacaaaagccctgaggaagcc
gataccatagagaaagtggcacagctctatgaactccaggagagaatgagggggaaataa

DBGET integrated database retrieval system