KEGG   Palaeococcus pacificus: PAP_02420Help
Entry
PAP_02420         CDS       T03210                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
ppac  Palaeococcus pacificus
Pathway
ppac00500  Starch and sucrose metabolism
ppac01100  Metabolic pathways
ppac01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAP_02420
Enzymes [BR:ppac01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     PAP_02420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 Sda T2SSF
Motif
Other DBs
NCBI-ProteinID: AIF68914
UniProt: A0A075LRF9
LinkDB All DBs
Position
complement(414393..416897)
Genome map
AA seq 834 aa AA seqDB search
MEEIKSKIESKLPENIKGLLELAYNYWWSWSRRATSLWGHIDSEHWREYKNPVKLLLDVD
EERLNELAKDEKFIDLYEFVMDKFERYMNEKNTWFSTNYPKWDKPIVYLCMEYGISKSLP
IYSGGLGILAGDHVKTASDLGLPFIAIGLLYKHGYFKQEIDKDGKQIEVFPLYNPVEMPM
KPVRKENGELLLIEVPIDNKIIYARVFEVNVGRVKLYLLDTDIEENPPEDRITCDYLYNP
EMNNRVSQEILLGIGGMKLLEALKIEAGVIHLNEGHPAFANFERIRRYMEEGLTFEEALE
VVRGTSVFTTHTPVPAGHDKFPIELVEKKLEKFFEGLPKEKFLSLGKTDKNDKEFNMTLL
AIRTSNFVNGVSKLHAEVSKKMWKNLWKEIPLDEMPIEGITNGVHTLTWVHNAIARLYDR
YMGKVWRDHINLEGIWYAVEVIPDEELWEAHLKAKKDFIKLIQRKIMRRNKRLGINEPIP
EIDENALIIGFARRFATYKRATLLLSDLERLKKIVNNPEKPVYIVFAGKAHPRDDAGKEF
LRKVYEVSQMPEFKGKIIVFENYDMGSARLMVAGVDVWLNNPRRPLEASGTSGMKAGLNG
VLNLSTYDGWWVEGYNGKNGWVIGDETTEPESEEDDYRDAQSLYELLEKEVIPTYYENRE
KWTEMMKESIKTIAPLFSTHRMLKEYMTKFYTKAMEHGIWLKKDGFKWARELAEWKEKVF
SSWDRVKIEGITTQNARSVEVVVNLDGLSPEDVKVEMYYGVKAEGYMIEKPYIIELRHPQ
ELGNGRWKYKYEGNALKNLGNPCWHYAIRVYPHHDKLPYKFLLGLIKWKGFFEF
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atggaagagataaagagcaagattgaatcaaagctccctgaaaatattaagggtctacta
gagttggcttataactattggtggagctggtctaggagagcaacttcactgtggggacat
atagattccgagcactggagggaatataaaaatcctgtaaagctcctcctcgacgttgat
gaagagcgtttaaatgaacttgcaaaggatgaaaagttcatagacctgtacgaatttgtg
atggacaaatttgagaggtacatgaacgagaaaaacacttggttctctaccaactaccca
aagtgggacaaacccatagtctatctctgtatggagtacggcataagcaaaagcctgcca
atttattcaggaggtttaggaattctcgcgggagatcatgttaagacggcgagcgatttg
ggactaccgttcattgcaataggactcctctacaagcatggatacttcaaacaagaaata
gacaaggatggtaagcaaattgaagtgttccccctttacaaccccgtagaaatgccaatg
aagccagttcgcaaagaaaatggagagctgcttttgattgaggttcccatagacaacaaa
atcatttatgcaagggttttcgaagtaaacgtgggtagggtaaaactctatcttctagat
actgacatcgaggagaatcctccagaggacagaattacctgcgactacctctacaaccca
gagatgaacaacagagtcagccaagagattcttcttgggataggaggaatgaaacttttg
gaggctttaaaaattgaggctggagtaatccacttaaatgaaggccatcccgcctttgca
aactttgagagaataaggagatacatggaagaaggcctaactttcgaagaggctttagag
gttgtgagggggacgagtgttttcacaacccatactcccgttcctgcaggtcatgataaa
ttccccattgaactcgtggagaaaaagcttgagaagttctttgaaggacttccaaaggaa
aaattcctgtctctaggcaaaaccgataaaaacgacaaagaatttaacatgacgctttta
gccataagaacctcaaactttgtgaatggtgtcagcaaactccatgcagaggtctcaaag
aagatgtggaagaacttatggaaagagatcccactagatgaaatgcctatagaagggata
acaaacggtgtgcacacgttaacttgggttcacaatgccatagcaaggctctacgataga
tacatgggcaaagtttggagggatcatataaacttagagggcatttggtatgctgttgaa
gttatccccgatgaagagctctgggaggctcacttaaaagcaaagaaggatttcattaag
ctcatacagaggaagataatgagaaggaataagcgcttaggtataaatgaaccaattccc
gagatagatgaaaacgccttgataataggctttgcgagaaggtttgcaacttacaaaaga
gccacgctgttattaagtgaccttgagaggcttaagaaaatagttaacaatccagagaaa
cccgtctacatcgtctttgccggaaaagcccatccaagagacgacgctgggaaagaattc
cttaggaaagtctatgaagtttcacaaatgcccgaatttaaagggaaaataattgtcttt
gagaactatgacatgggctccgcaagattgatggtagctggagttgatgtttggttaaac
aatcccagaaggccgctagaagcaagcggaacgagcggcatgaaagccggactcaacggt
gtgcttaacttaagtacatacgatggctggtgggtcgagggatataatggaaagaacgga
tgggtgataggagacgaaacaacagaacctgagagtgaagaggacgactatagagatgcc
caaagcttatacgagctcctagaaaaggaagtaatcccaacatactacgaaaacagggaa
aaatggacagagatgatgaaagaaagcataaagactatagcacctctctttagcacccac
agaatgctaaaagagtacatgacaaaattctacacaaaggctatggagcacggaatttgg
cttaagaaagatgggttcaagtgggctagagagctggcggagtggaaggaaaaagtcttc
tcatcgtgggacagagtgaagatagagggcattaccacacaaaatgcaagaagcgttgag
gttgtggtcaatctcgacgggctaagcccagaggacgttaaagttgagatgtactatgga
gttaaagcggaaggatatatgatagaaaagccctacataatagagctcagacaccctcaa
gagctcggaaatggcagatggaaatacaaatacgaaggaaacgctctcaaaaacttagga
aacccgtgctggcactacgccattagagtgtacccacaccacgacaagctgccctacaag
ttcttgcttgggttgatcaaatggaagggcttttttgagttctga

DBGET integrated database retrieval system