KEGG   Palaeococcus pacificus: PAP_05415Help
Entry
PAP_05415         CDS       T03210                                 

Definition
(GenBank) endonuclease
  KO
K02319  DNA polymerase, archaea type [EC:2.7.7.7]
Organism
ppac  Palaeococcus pacificus
Pathway
ppac03030  DNA replication
Brite
KEGG Orthology (KO) [BR:ppac00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PAP_05415
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppac03032]
    PAP_05415
Enzymes [BR:ppac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PAP_05415
DNA replication proteins [BR:ppac03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    B-family DNA polymerases
     PAP_05415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 LAGLIDADG_3 RNase_H_2 DNA_pol_B_exo2 Intein_splicing Vint Redoxin LAGLIDADG_2 Hint
Motif
Other DBs
NCBI-ProteinID: AIF69486
UniProt: A0A075LTP1
LinkDB All DBs
Position
complement(961202..964609)
Genome map
AA seq 1135 aa AA seqDB search
MILDTDYITENGKPVIRIFKKENKKFKIEYDRSFEPYIYALLESDDAIEEIKKITAARHG
KVVKVKKTEKVEKKFLGEPISVWRLVFEHPQDVPAIRDAIRAHPAVLEIFEYDIPFAKRY
LIDKGLIPMEGDEELKLLAFDIETLYHEGEEFGEGPILMISYADEDEAKVITWKRIDEPY
VEVVSTERDMIKHFLRVVKEKDPDVLITYNGDNFDFAYIKKRCEKLGLKFTLGRDGSEPK
IQRMGDRFAVEVKGRIHLDLYPVVRHTIRLTTYTLEAVYEAVLGKKKSKVYAKDITRAWE
NEEGLKQVALYSMEDAKATYELGKEFFPMEVELAKLIGQSVWDVSRSSTGNLVEWYLLRV
AYERNELAPNKPSDEEYRKRMRSSYLGGYVKEPEKGLWGNIVYLDFRCHPADTKVVVKDK
GIVNISEVKEGDYVLGINGWHKVLKVWEYDYDGELVNVNGLRCTPNHKLPIVTQKERQTS
IRDSYAKSMLTNKVKGKLITTELFEAIGEIEKRKAELPEELILKSELAGIILAEGHMLRK
DVRYFDSSRGKHRISHQYRVEITVGEEETEFIQRIKYIFKKLFDCEPSIRRKKNTKALTL
QCAKKSVYLKIKEIMKGIENLDAASVLRGFFEGDGTVNVARRTIVVTQGTNNGNTIQLIS
KMLQKLGIRHSIYEYEYEERGKNLKRHILEIAWRGELVKFDVLVGFISSRKKSLLKEIIS
EKEMYRLKESGFYALDEVKAAKNYYKGKVYDLTLEGTPYYFANGILTHNSLYPSIIVTHN
VSPDTVEKEGCKNYDKAPIVGYRFCKDFKGFIPSILEELIETRQKIKRKMKATIDPIEKK
MLDYRQRAVKILANSYYGYMGYPKARWYSKECAESVTAWGRYYIDMTIKEIEKQGFKVLY
ADTDGFYATIPGEKVESIKKKAKEFLKYINSKLPGMLELEYEGFYVRGFFVTKKRYAVID
EEGKITTRGLEVVRRDWSDIAKETQAKVLEAILREGSVEKAAEIVKKVVEDLAKYKVPVE
KLVIHEQITRELKDYKATGPHVAIAKRLEARGIKVKPGTVISYVVLKGSGKISDRVILAE
EYNPEKHKYDPDYYIHNQVLPAVLRILEAFGYKEKDLEYQRMKQTGLGAWLKPKS
NT seq 3408 nt NT seq  +upstreamnt  +downstreamnt
atgattctcgacactgattacataaccgagaacgggaagcctgtaattaggattttcaag
aaggagaataaaaagtttaaaatagaatacgacaggagttttgaaccctacatttacgcg
cttcttgagagcgacgacgcaatagaggagattaaaaaaatcaccgctgcgaggcacggc
aaggttgttaaagttaagaagacagaaaaagttgagaaaaagttcttaggcgagcctata
agtgtctggcgcttagtttttgaacatccccaagatgtccccgccattagagatgccatt
agagcccatccagccgtgctggagatatttgagtacgacattccctttgcaaagcgctat
ttgatagataaaggtctaatcccaatggaaggagacgaggagcttaagctgctcgctttt
gacatcgagacgctctatcatgaaggggaggagttcggggaagggcccatccttatgata
agctatgccgatgaggacgaggctaaagtcataacctggaagcgcatcgacgagccttac
gttgaggtagtctcaactgagagagacatgataaagcactttttaagggtggtgaaggaa
aaagaccccgatgtactcattacctacaatggcgacaacttcgactttgcttacataaaa
aagcgctgtgaaaagctcggcttgaagtttactcttgggagagatgggagcgagcctaaa
atccagcgtatgggagatagatttgccgtggaagttaagggcaggatacacttagaccta
taccccgtagtgaggcacaccataagattaaccacatacacgctcgaggctgtttacgaa
gccgttttaggaaagaagaagagcaaagtttatgctaaagacataacgagggcatgggag
aacgaggaaggacttaaacaggtagctttgtactccatggaagatgccaaagcaacctac
gaactcggtaaagaattcttccctatggaggttgaattagcaaagctcataggacagagc
gtttgggatgtctcgcgctcgagcacgggcaacttagtggagtggtatctcctaagggtg
gcctatgagaggaatgaattagcaccaaacaagccaagtgatgaggaatataggaaaaga
atgcgctcttcttatttgggaggctacgttaaagagcctgaaaagggattatggggcaac
atcgtttatttagatttcaggtgtcatccggccgacacaaaggtcgtcgttaaggataaa
ggcatcgtgaacataagcgaagtcaaggagggggactatgttttaggaataaatggatgg
cacaaagttttgaaggtatgggagtatgactacgatggcgagctggtaaatgttaatggg
ctcagatgcacccccaaccataagttaccaatagttacccaaaaagaaagacagacttct
ataagagatagctacgcaaaatccatgctaaccaataaagtcaaagggaaactcatcaca
acggaactttttgaggcaataggtgaaatagaaaaaagaaaagcagagcttcctgaggag
ctaattctaaagagcgaacttgccggaataatcttagcggaagggcacatgttaagaaaa
gacgttagatatttcgactcctcacgaggaaaacacaggatttcacatcagtatcgggtt
gagataacggtaggcgaggaggaaaccgagtttatacagcgcataaagtacatcttcaaa
aagctgtttgactgcgaaccatcaataaggagaaagaagaacaccaaagccctgacactt
cagtgtgccaaaaaatccgtctacctaaaaatcaaggagattatgaaaggcatcgaaaac
ctcgacgctgcatcagtccttaggggattcttcgaaggcgatggaacggtaaacgtcgca
agaaggactattgttgtcacacagggtactaacaatgggaacacaattcagctaatctcg
aaaatgctacaaaagcttgggattaggcattctatatacgagtacgaatacgaagaaagg
ggcaagaatttaaaacgccacattttggaaatcgcatggagaggagagctcgtaaagttc
gatgttcttgttgggttcataagctcacgcaaaaagagccttctgaaggaaataatctca
gagaaagagatgtaccggcttaaagaaagcggcttctacgcacttgatgaggtcaaggca
gcgaaaaattactacaaaggcaaagtttatgatctaacacttgaaggaaccccttactac
ttcgctaatggtatattaacccacaattcgctttacccatccataatcgtcacccacaac
gtttctccggatactgtggaaaaagaaggatgcaaaaactacgacaaagctccaatcgta
ggctaccgcttttgcaaagactttaagggattcatcccaagcattctcgaggagctcata
gagacgagacaaaagataaagaggaagatgaaagccacaattgatccaatcgagaagaaa
atgctcgattacagacagcgagccgtcaaaatcctggccaactcatattacggctatatg
ggttatccaaaagcacgctggtattcaaaggagtgcgccgagagcgttacggcatggggg
agatactacattgacatgacgattaaagaaatcgaaaaacaaggctttaaagtgctctac
gccgacaccgatggattttatgcaacaattccgggcgaaaaagttgagagcatcaaaaag
aaggctaaagagttcttaaaatacataaactcaaagctgcctggaatgctcgagctcgag
tatgagggcttctacgttaggggtttctttgtcactaaaaagcgctacgctgtgatagat
gaggaagggaagattacaacgaggggcctcgaagtagtaaggagggactggagcgatata
gctaaggaaactcaagctaaagtgttggaggctattctaagggagggtagcgttgaaaag
gcagcagagatagtaaagaaagtcgttgaggatctagccaaatacaaagtgcccgttgag
aagctcgtcatccacgagcagataacgagagagctcaaagactataaagctactggcccc
cacgtggccatagcgaagcgcttggaagcaaggggcataaaggtgaagcccggaactgtg
ataagctacgttgtgctcaaggggagcgggaagataagcgacagggtgattttagcggag
gaatacaaccccgagaagcataagtacgaccccgactactacatccataatcaagttctt
ccagcggtgcttaggattttagaggcttttggatacaaggagaaggatttagagtaccag
aggatgaagcagacgggattgggggcttggttgaagccaaaaagttaa

DBGET integrated database retrieval system